Escherichia coli K-12 MG1655: b3610 Help Entry b3610             CDS       T00007                                  Symbol grxC Name (RefSeq) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism eco  Escherichia coli K-12 MG1655 Brite KEGG Orthology (KO) [BR:eco00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:eco03110]     b3610 (grxC) Chaperones and folding catalysts [BR:eco03110]  Protein folding catalysts   Protein disulfide isomerase    b3610 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR GST_N Thioredoxin_2 Thioredoxin_3 Motif Other DBs NCBI-GeneID:  948132 NCBI-ProteinID:  NP_418067 Pasteur:  grxC RegulonDB:  ECK120002175 ECOCYC:  EG12294 ASAP:  ABE-0011801 UniProt:  P0AC62 Structure PDB LinkDB All DBs Position complement(3784191..3784442) Genome browser AA seq 83 aa AA seqDB search MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatgttgaaatctataccaaagaaacctgcccgtattgccatcgtgcaaaagca ctgctgagcagcaagggcgtgagtttccaggagctgccgatcgatggcaacgccgccaag cgtgaagagatgatcaaacgcagcggtcgcaccacggttccccagatttttattgacgca cagcacattggcggctgtgatgacttgtatgcattggatgcacgtggtggactggatccc ctgctgaaataa

DBGET integrated database retrieval system