Escherichia coli K-12 MG1655: b3781 Help Entry b3781             CDS       T00007                                  Symbol trxA Name (RefSeq) thioredoxin 1   KO K03671   thioredoxin Organism eco  Escherichia coli K-12 MG1655 Brite KEGG Orthology (KO) [BR:eco00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:eco03110]     b3781 (trxA) Chaperones and folding catalysts [BR:eco03110]  Protein folding catalysts   Protein disulfide isomerase    b3781 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 TraF Thioredoxin_9 OST3_OST6 AhpC-TSA Redoxin Thioredoxin_3 Thioredoxin_7 Glrx-like Thioredoxin_6 DUF6568 HyaE Motif Other DBs NCBI-GeneID:  948289 NCBI-ProteinID:  NP_418228 Pasteur:  trxA RegulonDB:  ECK120001020 ECOCYC:  EG11031 ASAP:  ABE-0012357 UniProt:  P0AA25 Structure PDB LinkDB All DBs Position 3965761..3966090 Genome browser AA seq 109 aa AA seqDB search MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgagcgataaaattattcacctgactgacgacagttttgacacggatgtactcaaagcg gacggggcgatcctcgtcgatttctgggcagagtggtgcggtccgtgcaaaatgatcgcc ccgattctggatgaaatcgctgacgaatatcagggcaaactgaccgttgcaaaactgaac atcgatcaaaaccctggcactgcgccgaaatatggcatccgtggtatcccgactctgctg ctgttcaaaaacggtgaagtggcggcaaccaaagtgggtgcactgtctaaaggtcagttg aaagagttcctcgacgctaacctggcgtaa

DBGET integrated database retrieval system