Escherichia coli K-12 MG1655: b1094 Help Entry b1094             CDS       T00007                                  Symbol acpP Name (RefSeq) acyl carrier protein   KO K02078   acyl carrier protein Organism eco  Escherichia coli K-12 MG1655 Pathway eco01100   Metabolic pathways eco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eco00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     b1094 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     b1094 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB DUF1493 HLH Ribosomal_L50 Motif Other DBs NCBI-GeneID:  944805 NCBI-ProteinID:  NP_415612 Pasteur:  acpP RegulonDB:  ECK120002562 ECOCYC:  EG50003 ASAP:  ABE-0003703 UniProt:  P0A6A8 Structure PDB LinkDB All DBs Position 1151615..1151851 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system