Detailed view for LmjF.35.0520

Basic information

TDR Targets ID: 22016
Leishmania major, proteophosphoglycan ppg4
Source Database / ID:  TriTrypDB  GeneDB

pI: 6.62 | Length (AA): 7194 | MW (Da): 626431 | Paralog Number: 4

Signal peptide: Y | GPI Anchor: N | Predicted trans-membrane segments: 1

Druggability Group : DG1

Targets have been classified into druggability groups (DG) according to their druggability score in network driven prioritizations. DGs range from 1 to 5; the higher the group number, the higher the chance of the target to be druggable

Pfam domains

No Pfam domain information for this protein.

Gene Ontology

Mouse over links to read term descriptions.
GO:0005515   protein binding  

Metabolic Pathways

This gene is not mapped to any metabolic pathway in KEGG.

Structural information

Modbase 3D models:

There are 14 models calculated for this protein. More info on these models, including the models themselves is available at: Modbase

Target Beg Target End Template Template Beg Template End Identity Evalue Model Score MPQS zDope
201 292 1ogq (A) 83 175 35.00 0.000000059 0.99 0.55 -1.26
6986 7194 1ogq (A) 5 311 23.00 0 1 -0.34 0.26
7081 7191 1dce (A) 463 567 22.00 0 0.69 0.27 -0.97
126 276 4u08 (A) 209 358 27.00 0.00065 1 0.41249 -0.89
128 284 4qxf (A) 47 265 34.00 0.021 0.51 -0.124676 0.9
201 292 1ogq (A) 83 175 35.00 0.000000084 0.99 0.534288 -1.1
834 949 3s6l (A) 13 132 33.00 0.000055 0.13 0.271625 0.1
2389 2482 1oqy (A) 77 161 38.00 0.00015 0 0.137566 1.28
3682 3801 2k3o (A) 2 121 32.00 0.00029 0.21 0.306181 0.24
5867 6023 2k3n (A) 3 162 31.00 0.000000019 0.03 0.204324 0.93
6891 7050 1g66 (A) 10 181 28.00 0.93 0.26 0.0777408 0.63
6990 7177 4z5w (A) 31 230 30.00 0.00000045 1 0.298633 -0.6
7066 7172 5gr9 (B) 210 317 38.00 0.000000000006 1 0.582373 -1.15
7100 7165 4u06 (A) 156 219 41.00 0.0023 0.97 0.541674 -0.83

Help me make sense of these data.

Target Beg: first modeled residue
Target End: last modeled residue
Template: template structure used for modelling (PDB accession and chain)
Template Beg: first template residue in target-template alignment
Template End: last template residue in target-template alignment
Identity: sequence identity
Evalue: E value for target-template hit
Model Score: GA341 score (>0.7 for reliable model)
MPQS: ModPipe Quality Score (>1.1 for reliable model)
zDope: zDope Score (negative for reliable model)

A more detailed description of these scores is available at the Modbase Model Evaluation Help Pages, and in the papers referenced therein.

PDB Structures:

No structure availble in the PDB for this protein

Expression

Upregulation Percent Ranking Stage Dataset
Lower 0-20% percentile amastigotes, metacyclic. Fernandes MC
Show/Hide expression data references
  • Fernandes MC Dual Transcriptome Profiling of Leishmania-Infected Human Macrophages Reveals Distinct Reprogramming Signatures.

Orthologs

Ortholog group members (OG5_126579)

Species Accession Gene Product
Arabidopsis thaliana AT3G12145   leucine-rich repeat protein FLOR1
Arabidopsis thaliana AT4G18600   SCAR family protein WAVE5
Babesia bovis BBOV_IV000140   hypothetical protein
Babesia bovis BBOV_IV003650   hypothetical protein
Babesia bovis BBOV_IV004080   membrane protein, putative
Brugia malayi Bm1_40520   Lectin C-type domain containing protein
Brugia malayi Bm1_43885   PAN domain containing protein
Brugia malayi Bm1_06695   hypothetical protein
Candida albicans CaO19.79   similar to internal repeat region of ALS4 (AAG25054), ALS3 (AAC39486), ALS1 (AAC41649), etc.
Candida albicans CaO19.7400   agglutinin-like protein
Candida albicans CaO19.8979   Enhanced Adherence to Polystyrene
Candida albicans CaO19.1490   similar to S. cerevisiae MUC1 (YIR019C) cell surface flocculin
Candida albicans CaO19.5736   agglutinin-like protein
Candida albicans CaO19.13163   agglutinin-like protein
Candida albicans CaO19.13168   best match to 5' end of 3' partial cds for ALS9 (AAK00765)
Candida albicans CaO19.10888   potential hyphal form cell wall protein similar to S. cerevisiae MUC1 (YIR019C) cell surface flocculin
Candida albicans CaO19.1098   almost identical to ALS2-1 allele 3' partial cds (AAC64236)
Candida albicans CaO19.9183   low complexity, reptitive protein similar to cell surface flocculin-like protein
Candida albicans CaO19.1616   low complexity, reptitive protein similar to cell surface flocculin-like protein
Candida albicans CaO19.4075   low complexity orf
Candida albicans CaO19.45   agglutinin-like protein
Candida albicans CaO19.3380   potential hyphal form cell wall protein similar to S. cerevisiae MUC1 (YIR019C) cell surface flocculin
Candida albicans CaO19.9670   likely frameshifted C terminus of ALS4-like CaP19.9669
Candida albicans CaO19.5745   best match to 5' end of 3' partial cds for ALS9 (AAK00765)
Candida albicans CaO19.9067   similar to S. cerevisiae MUC1 (YIR019C) cell surface flocculin
Candida albicans CaO19.2355   agglutinin-like protein
Candida albicans CaO19.13166   consists of 13 repeats of MVVVLANDSDQNSVVVTVGLCGSLTMTEFVPSGGLV
Candida albicans CaO19.13158   agglutinin-like protein
Candida albicans CaO19.9891   agglutinin-like protein
Candida albicans CaO19.8700   almost identical to ALS2-1 allele 3' partial cds (AAC64236) up to end of contig
Candida albicans CaO19.2122   likely frameshifted C terminus of ALS4-like CaP19.2121
Candida albicans CaO19.9669   DNA similarity to ALS4-like sequence (AAG25054) continues to 5' end of contig and past stop codon of this orf, frameshifts to Ca
Candida albicans CaO19.5741   agglutinin-like protein
Candida albicans CaO19.4556   very good match to ALS4-2, 3' partial cds (AAC64242)
Candida albicans CaO19.7414   agglutinin-like protein almost identical to ALS6 (AAO72081)
Candida albicans CaO19.2121   DNA similarity to ALS4-like sequence (AAG25054) continues to 5' end of contig and past stop codon of this orf, frameshifts to Ca
Candida albicans CaO19.1401   Enhanced Adherence to Polystyrene
Caenorhabditis elegans CELE_C03E10.5   Protein CLEC-223
Caenorhabditis elegans CELE_H02F09.3   Protein H02F09.3
Caenorhabditis elegans CELE_ZC178.2   Protein ZC178.2
Caenorhabditis elegans CELE_F16F9.2   Protein DPY-6
Caenorhabditis elegans CELE_T06D8.1   Protein SRAP-1, isoform A
Caenorhabditis elegans CELE_H43E16.1   Protein H43E16.1
Cryptosporidium hominis Chro.20329   hypothetical protein
Cryptosporidium parvum cgd2_3130   hypothetical protein with possible transcriptional repressor EZH1 domain
Cryptosporidium parvum cgd4_3630   conserved hypothetical protein
Dictyostelium discoideum DDB_G0287863   hypothetical protein
Dictyostelium discoideum DDB_G0283585   hypothetical protein
Dictyostelium discoideum DDB_G0302588   RanBP2-type zinc finger
Dictyostelium discoideum DDB_G0285923   hypothetical protein
Dictyostelium discoideum DDB_G0274915   hypothetical protein
Dictyostelium discoideum DDB_G0290651   hypothetical protein
Dictyostelium discoideum DDB_G0295727   hypothetical protein
Drosophila melanogaster Dmel_CG4090   Mucin related 89F
Drosophila melanogaster Dmel_CG7002   Hemolectin
Drosophila melanogaster Dmel_CG33196   dumpy
Drosophila melanogaster Dmel_CG33265   Mucin 68E
Drosophila melanogaster Dmel_CG33300   Mucin 30E
Drosophila melanogaster Dmel_CG18331   Mucin 68Ca
Drosophila melanogaster Dmel_CG32580   Mucin 14A
Drosophila melanogaster Dmel_CG14796   Mucin related 2B
Drosophila melanogaster Dmel_CG32602   Mucin 12Ea
Drosophila melanogaster Dmel_CG3047   Salivary gland secretion 1
Drosophila melanogaster Dmel_CG42525   CG42525 gene product from transcript CG42525-RB
Escherichia coli b1978   putative adhesin
Echinococcus granulosus EgrG_000745400   protein split ends
Echinococcus granulosus EgrG_000417500   hypothetical protein
Echinococcus granulosus EgrG_000555200   expressed protein
Entamoeba histolytica EHI_188000   hypothetical protein
Echinococcus multilocularis EmuJ_000745400   protein split ends
Echinococcus multilocularis EmuJ_000417500   conserved hypothetical protein
Echinococcus multilocularis EmuJ_001105600   hypothetical protein
Echinococcus multilocularis EmuJ_000937900   expressed protein
Homo sapiens 102723856   flocculation protein FLO11-like
Homo sapiens ENSG00000117983   mucin 5B, oligomeric mucus/gel-forming
Homo sapiens ENSG00000169876   mucin 17, cell surface associated
Homo sapiens ENSG00000261272   mucin 22
Homo sapiens 101930440   collagen alpha-5(IV) chain-like
Homo sapiens 102725024   mucin-6-like
Homo sapiens ENSG00000110799   von Willebrand factor
Homo sapiens 102725014   collagen alpha-3(IV) chain-like
Homo sapiens ENSG00000184956   mucin 6, oligomeric mucus/gel-forming
Homo sapiens ENSG00000165899   otogelin-like
Homo sapiens 283463   mucin 19, oligomeric
Homo sapiens ENSG00000197558   SCO-spondin
Homo sapiens ENSG00000181143   mucin 16, cell surface associated
Homo sapiens ENSG00000205277   mucin 12, cell surface associated
Homo sapiens 4583   mucin 2, oligomeric mucus/gel-forming
Homo sapiens ENSG00000215182   mucin 5AC, oligomeric mucus/gel-forming
Homo sapiens ENSG00000145113   mucin 4, cell surface associated
Homo sapiens ENSG00000188162   otogelin
Leishmania braziliensis LbrM.34.0530   proteophosphoglycan ppg4
Leishmania braziliensis LbrM.34.0520   proteophosphoglycan ppg3, putative
Leishmania braziliensis LbrM.34.0540   proteophosphoglycan ppg4
Leishmania braziliensis LbrM.06.1290   hypothetical protein, PPG
Leishmania braziliensis LbrM.34.0550   proteophosphoglycan ppg3, putative
Leishmania donovani LdBPK_060810.1   hypothetical protein, unknown function
Leishmania infantum LinJ.35.0540   proteophosphoglycan 5
Leishmania infantum LinJ.35.0500   proteophosphoglycan ppg3, putative
Leishmania infantum LinJ.06.0810   hypothetical protein, unknown function
Leishmania infantum LinJ.35.0530   proteophosphoglycan 5
Leishmania infantum LinJ.35.0520   proteophosphoglycan ppg4
Leishmania infantum LinJ.35.0510   proteophosphoglycan ppg4
Leishmania infantum LinJ.35.0490   proteophosphoglycan ppg4
Leishmania infantum LinJ.35.0550   proteophosphoglycan ppg1
Leishmania major LmjF.35.0520   proteophosphoglycan ppg4
Leishmania major LmjF.35.0500   proteophosphoglycan ppg3, putative
Leishmania major LmjF.35.0540   proteophosphoglycan 5
Leishmania major LmjF.06.0780   hypothetical protein, unknown function
Leishmania major LmjF.35.0550   proteophosphoglycan ppg1
Leishmania mexicana LmxM.34.0540  
Leishmania mexicana LmxM.34.0500a  
Leishmania mexicana LmxM.34.0500   proteophosphoglycan ppg3, putative
Leishmania mexicana LmxM.34.0550   proteophosphoglycan ppg1
Loa Loa (eye worm) LOAG_05397   hypothetical protein
Loa Loa (eye worm) LOAG_02844   hypothetical protein
Loa Loa (eye worm) LOAG_02211   hypothetical protein
Loa Loa (eye worm) LOAG_03163   hypothetical protein
Loa Loa (eye worm) LOAG_03162   hypothetical protein
Mus musculus ENSMUSG00000079620   mucin 4
Mus musculus 102633933   predicted gene, 31635
Mus musculus 78672   RIKEN cDNA 9530057J20 gene
Mus musculus 17831   mucin 2
Mus musculus ENSMUSG00000001930   Von Willebrand factor homolog
Mus musculus ENSMUSG00000066108   mucin 5, subtype B, tracheobronchial
Mus musculus 102636358   predicted gene, 33446
Mus musculus ENSMUSG00000091455   otogelin-like
Mus musculus 102642957   uncharacterized LOC102642957
Mus musculus 101056219   uncharacterized LOC101056219
Mus musculus 102642001   aggrecan core protein-like
Mus musculus ENSMUSG00000029797   SCO-spondin
Mus musculus 102633703   predicted gene, 31464
Mus musculus 239611   mucin 19
Mus musculus 666185   predicted gene 7969
Mus musculus 102633718   predicted gene, 31477
Mus musculus 102633301   predicted gene, 31160
Mus musculus 102639120   predicted gene, 35508
Mus musculus ENSMUSG00000009487   otogelin
Mus musculus 101055850   predicted gene, 29731
Mus musculus ENSMUSG00000037974   mucin 5, subtypes A and C, tracheobronchial/gastric
Mus musculus 102643019   putative proline-rich protein 21-like
Mus musculus ENSMUSG00000048191   mucin 6, gastric
Mus musculus 101055860   predicted gene, 29734
Neospora caninum NCLIV_010780   hypothetical protein
Neospora caninum NCLIV_012940   hypothetical protein, conserved
Neospora caninum NCLIV_038040   protein kinase, PfEST homolog, putative
Oryza sativa 4352173   Os12g0456400
Oryza sativa 4330178   Os02g0653200
Oryza sativa 4347693   Os09g0535200
Onchocerca volvulus OVOC10258  
Plasmodium falciparum PF3D7_0501400   interspersed repeat antigen
Plasmodium yoelii PY06855   Drosophila melanogaster CG5228 gene product
Saccharomyces cerevisiae YGR014W   Msb2p
Saccharomyces cerevisiae YAL063C   Flo9p
Saccharomyces cerevisiae YAR050W   Flo1p
Saccharomyces cerevisiae YIL169C   hypothetical protein
Saccharomyces cerevisiae YDL039C   Prm7p
Saccharomyces cerevisiae YDR420W   Hkr1p
Saccharomyces cerevisiae YCR089W   Fig2p
Saccharomyces cerevisiae YMR317W   hypothetical protein
Saccharomyces cerevisiae YHR211W   Flo5p
Saccharomyces cerevisiae YOL155C   Hpf1p
Saccharomyces cerevisiae YIR019C   Flo11p
Schistosoma japonicum Sjp_0099630   expressed protein
Schistosoma japonicum Sjp_0057190   Protein split ends, putative
Schistosoma japonicum Sjp_0125370   Mucin-16, putative
Schistosoma mansoni Smp_159350   platelet binding protein-related
Schmidtea mediterranea mk4.021208.00  
Schmidtea mediterranea mk4.000308.02  
Schmidtea mediterranea mk4.015403.00  
Schmidtea mediterranea mk4.000911.03  
Schmidtea mediterranea mk4.000308.03  
Schmidtea mediterranea mk4.004800.00  
Schmidtea mediterranea mk4.000191.16  
Schmidtea mediterranea mk4.000911.04  
Schmidtea mediterranea mk4.002886.02   Platelet binding protein-related
Schmidtea mediterranea mk4.000191.12  
Schmidtea mediterranea mk4.001252.02  
Schmidtea mediterranea mk4.000191.11  
Trypanosoma brucei gambiense Tbg972.10.19230  
Trypanosoma brucei gambiense Tbg972.10.19140  
Trypanosoma brucei Tb11.1200   hypothetical protein
Trypanosoma brucei Tb927.9.2080   invariant surface glycoprotein 100, point mutation
Trypanosoma brucei Tb11.1190   hypothetical protein
Trypanosoma brucei Tb927.10.15700   hypothetical protein, conserved
Toxoplasma gondii TGME49_268010   hypothetical protein
Toxoplasma gondii TGME49_212810   hypothetical protein
Toxoplasma gondii TGME49_306390   hypothetical protein
Toxoplasma gondii TGME49_239270   hypothetical protein
Theileria parva TP02_0503   hypothetical protein
Trichomonas vaginalis TVAG_097910   nuclear anchorage protein, putative
Trichomonas vaginalis TVAG_032240   conserved hypothetical protein
Trichomonas vaginalis TVAG_098350   conserved hypothetical protein

Essentiality

LmjF.35.0520 has one or more orthologs with essentiality data
Gene/Ortholog Organism Phenotype Source Study
Tb927.10.15700 Trypanosoma brucei no significant loss or gain of fitness in bloodstream forms (3 days) alsford
Tb927.10.15700 Trypanosoma brucei no significant loss or gain of fitness in bloodstream forms (6 days) alsford
Tb927.10.15700 Trypanosoma brucei no significant loss or gain of fitness in procyclic forms alsford
Tb927.10.15700 Trypanosoma brucei significant gain of fitness in differentiation of procyclic to bloodstream forms alsford
b1978 Escherichia coli non-essential goodall
YDR420W Saccharomyces cerevisiae inviable yeastgenome
TGME49_212810 Toxoplasma gondii Essentiality uncertain sidik
TGME49_239270 Toxoplasma gondii Essentiality uncertain sidik
TGME49_306390 Toxoplasma gondii Essentiality uncertain sidik
TGME49_268010 Toxoplasma gondii Essentiality uncertain sidik
TGME49_212810 Toxoplasma gondii Probably essential sidik
TGME49_239270 Toxoplasma gondii Probably essential sidik
TGME49_306390 Toxoplasma gondii Probably essential sidik
TGME49_268010 Toxoplasma gondii Probably essential sidik
Show/Hide essentiality data references
  • yeastgenome Systematic deletion of yeast genes Saccharomyces Genome Database
  • shigen Profiling of E. coli Chromosome (PEC) National Institute of Genetics, Japan
  • wormbase C. elegans RNAi experiments WormBase web site, http://www.wormbase.org, release WS170
  • neb C. elegans RNAi phenotypes Data obtained from Wormbase WS150, curated by K. Chaudary and T. Carlow, New England Biolabs
  • keio Systematic single-gene knock-out mutants of E. coli K12 The Keio Collection
  • sidik A Genome-wide CRISPR Screen in Toxoplasma Identifies Essential Apicomplexan Genes. Sidik, Saima M., et al. "A genome-wide CRISPR screen in toxoplasma identifies essential apicomplexan genes." Cell 166.6 (2016): 1423-1435.
  • goodall The Essential Genome of Escherichia coli K-12 (Transposon directed high-throughput mutagenesis) Goodall, Emily CA, et al. "The essential genome of Escherichia coli K-12." mBio 9.1 (2018): e02096-17.
  • gerdes Experimental determination and system-level analysis of essential genes in E. coli MG1655 Gerdes et al., J Bacteriol. 2003 185:5673-84
  • alsford High-throughput phenotyping using parallel sequencing of RNA interference targets in the African trypanosome Genome Res 2011, 21:915-924
  • nmpdr Genome-scale essentiality datasets from published studies (M. tuberculosis) National Microbial Pathogen Data Resource
  • plasmo Functional Profiling of a Plasmodium Genome Reveals an Abundance of Essential Genes. Bushell, Ellen, et al. "Functional profiling of a Plasmodium genome reveals an abundance of essential genes." Cell 170.2 (2017): 260-272.
  • blattner Systematic mutagenesis of the E. coli (MG1655) genome J Bacteriol 2004, 186:4921-4930

Phenotypes and Validation (curated)

We have no manually annotated phenotypes for this target. What does this mean? / Care to help?

In TDR Targets, information about phenotypes that are caused by drugs, or by genetic manipulation of cells (e.g. gene knockouts or knockdowns) is manually curated from the literature. These descriptions help to describe the potential of the target for drug development. If no information is available for this gene or if the information is incomplete, this may mean that i) the papers containing this information either appeared after the curation effort for this organism was carried out or they were inadvertently missed by curators; or that ii) the curation effort for this organism has not yet started.

In any case, if you have information about papers containing relevant validation data for this target, please contact us.

Annotated validation

No validation data for this target

Associated compounds / Druggability

Druggability index (range: 0 to 1): 0.3

Known modulators for this target

No chemical compounds associated to this gene

Predicted associations

By orthology with druggable targets
Non orthologous druggable targets
By sequence similarity to non orthologous druggable targets
No additional associated druggable targets
Obtained from network model
No druggable targets predicted through repurposing network model

Assayability

Assay information

No assay information for this target.

Reagent availability

No reagent availability information for this target.

Bibliographic References

No literature references available for this target.

If you have references for this gene, please enter them in a user comment (below) or Contact us.

User comments

No user comments are available for this gene. Log in to add comments, or register.

Enter your comment

User ()
Gene identifier LmjF.35.0520 (Leishmania major), proteophosphoglycan ppg4
Title for this comment
Comment