Detailed information for compound 941815

Basic information

Technical information
  • Name: Unnamed compound
  • MW: 414.524 | Formula: C20H26N6O2S
  • H donors: 1 H acceptors: 4 LogP: 1.24 Rotable bonds: 3
    Rule of 5 violations (Lipinski): 1
  • SMILES: C[C@@H]1Cn2ncc(c2CN1c1ccnc2c1cc[nH]2)C1CCN(CC1)S(=O)(=O)C
  • InChi: 1S/C20H26N6O2S/c1-14-12-26-19(13-25(14)18-4-8-22-20-16(18)3-7-21-20)17(11-23-26)15-5-9-24(10-6-15)29(2,27)28/h3-4,7-8,11,14-15H,5-6,9-10,12-13H2,1-2H3,(H,21,22)/t14-/m1/s1
  • InChiKey: RUBCMYKDFDSVRG-CQSZACIVSA-N  


Substructure search Similarity search

Network

Hover on a compound node to display the structore

Synonyms

No synonyms found for this compound

Targets

Known targets for this compound

Species Target name Source Bibliographic reference
Homo sapiens ATR serine/threonine kinase Starlite/ChEMBL References
Homo sapiens checkpoint kinase 1 Starlite/ChEMBL References
Homo sapiens ATM serine/threonine kinase Starlite/ChEMBL References
Homo sapiens protein kinase, DNA-activated, catalytic polypeptide Starlite/ChEMBL References
Homo sapiens mechanistic target of rapamycin (serine/threonine kinase) Starlite/ChEMBL References

Predicted pathogen targets for this compound

By orthology
Species Potential target Known druggable target/s Ortholog Group
Leishmania mexicana phosphatidylinositol 3-kinase (tor2)-like protein Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei gambiense phosphatidylinositol 3 kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis DNA dependent protein kinase catalytic subunit Get druggable targets OG5_132688 All targets in OG5_132688
Neospora caninum phosphatidylinositol 3- and 4-kinase domain- containing protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Candida albicans frameshifted from upstream TOR2 CDS (CaP19.1905) Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania braziliensis target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica FKBP-rapamycin associated protein (FRAP), putative Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania donovani phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Leishmania major phosphatidylinositol kinase related protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Entamoeba histolytica hypothetical protein Get druggable targets OG5_128955 All targets in OG5_128955
Leishmania braziliensis phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Schistosoma japonicum IPR000971,Globin;IPR012292,Globin-related;IPR009050,Globin-like,domain-containing Get druggable targets OG5_128955 All targets in OG5_128955
Schistosoma japonicum Serine/threonine-protein kinase atr, putative Get druggable targets OG5_128386 All targets in OG5_128386
Cryptosporidium hominis ataxia telangiectasia and Rad3-related protein Get druggable targets OG5_128386 All targets in OG5_128386
Candida albicans similar to internal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in n Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_130454 All targets in OG5_130454
Schistosoma japonicum ko:K07203 FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei phosphatidylinositol 3-kinase tor, putative Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans similar to putative phosphatidylinositol kinase involved in telomere length regulation Get druggable targets OG5_128955 All targets in OG5_128955
Schistosoma japonicum ko:K06640 ataxia telangiectasia and Rad3 related, putative Get druggable targets OG5_128386 All targets in OG5_128386
Loa Loa (eye worm) CAMK/CAMKL/CHK1 protein kinase Get druggable targets OG5_130454 All targets in OG5_130454
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_128955 All targets in OG5_128955
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei gambiense phosphatidylinositol kinase domain protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Candida albicans frameshifted from upsteam TOR2 CDS (CaP19.9461) Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans similar to putative phosphatidylinositol kinase involved in telomere length regulation Get druggable targets OG5_128955 All targets in OG5_128955
Trypanosoma brucei phosphatidylinositol kinase related protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Trypanosoma congolense Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus phosphatidylinositol 3 and 4 kinase Get druggable targets OG5_128386 All targets in OG5_128386
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Leishmania major target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum Serine/threonine-protein kinase Chk1, putative Get druggable targets OG5_130454 All targets in OG5_130454
Cryptosporidium hominis hypothetical protein Get druggable targets OG5_128386 All targets in OG5_128386
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_128386 All targets in OG5_128386
Candida albicans similar to internal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in n Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans similar to N terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) putative protein/phosphatidylinositol kinases in Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania infantum target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus DNA dependent protein kinase catalytic subunit Get druggable targets OG5_132688 All targets in OG5_132688
Leishmania braziliensis phosphatidylinositol kinase related protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Giardia lamblia GTOR Get druggable targets OG5_127212 All targets in OG5_127212
Toxoplasma gondii target of rapamycin (TOR), putative Get druggable targets OG5_127212 All targets in OG5_127212
Cryptosporidium hominis hypothetical protein Get druggable targets OG5_128386 All targets in OG5_128386
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) phosphatidylinositol 3 Get druggable targets OG5_128386 All targets in OG5_128386
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_128386 All targets in OG5_128386
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis FKBP12 rapamycin complex associated protein Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania infantum phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Echinococcus multilocularis serine protein kinase ATM Get druggable targets OG5_128955 All targets in OG5_128955
Schistosoma mansoni ataxia telangiectasia mutated (atm)-related Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum ko:K04728 ataxia telangectasia mutated family protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Candida albicans potential phosphatidylinositol kinase similar to S. cerevisiae MEC1 (YBR136W) involved in DNA repair and recombination Get druggable targets OG5_128386 All targets in OG5_128386
Trypanosoma brucei phosphatidylinositol 4-kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica phosphatidylinositol3-kinaseTor2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica Phosphatidylinositol 3- and 4-kinase family Get druggable targets OG5_128386 All targets in OG5_128386
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania infantum target of rapamycin (TOR) kinase 1, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus FKBP12 rapamycin complex associated protein Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma congolense Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi phosphatidylinositol kinase related protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Schistosoma mansoni phosphatidylinositol 3-and 4-kinase Get druggable targets OG5_128386 All targets in OG5_128386
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_128386 All targets in OG5_128386
Cryptosporidium parvum FRP1 like protein involved in DNA repair with a FAT domain and a phosphatidylinositol kinase domain at the C-terminus Get druggable targets OG5_128386 All targets in OG5_128386
Echinococcus granulosus serine protein kinase ATM Get druggable targets OG5_128955 All targets in OG5_128955
Leishmania infantum phosphatidylinositol kinase related protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Trypanosoma brucei Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania donovani phosphatidylinositol 3-kinase-like protein Get druggable targets OG5_128955 All targets in OG5_128955
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania major target of rapamycin (TOR) kinase 1, putative Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans similar to N terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) putative protein/phosphatidylinositol kinases in Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_128386 All targets in OG5_128386
Trypanosoma brucei phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Toxoplasma gondii FATC domain-containing protein Get druggable targets OG5_128955 All targets in OG5_128955
Leishmania major phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Leishmania donovani Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum Serine/threonine-protein kinase ATR, putative Get druggable targets OG5_128386 All targets in OG5_128386
Candida albicans identical to the C terminus of CaP19.5580 potential phosphatidylinositol kinase Get druggable targets OG5_128955 All targets in OG5_128955
Schistosoma mansoni ataxia telangiectasia mutated (atm) Get druggable targets OG5_128955 All targets in OG5_128955
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_128386 All targets in OG5_128386
Neospora caninum Phosphatidylinositol 3-kinase tor2, related Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania donovani Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania mexicana phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Babesia bovis phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_128386 All targets in OG5_128386
Schistosoma japonicum hypothetical protein Get druggable targets OG5_128955 All targets in OG5_128955
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Neospora caninum phosphatidylinositol 3- and 4-kinase domain- containing protein, putative Get druggable targets OG5_128386 All targets in OG5_128386
Schistosoma japonicum hypothetical protein Get druggable targets OG5_128386 All targets in OG5_128386
Trypanosoma brucei gambiense phosphatidylinositol 3-related kinase, putative Get druggable targets OG5_128386 All targets in OG5_128386
Leishmania mexicana phosphatidylinositol 3 kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi phosphatidylinositol kinase related protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Trypanosoma brucei gambiense phosphatidylinositol 3-kinase tor, putative Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania mexicana phosphatidylinositol 3-kinase-like protein Get druggable targets OG5_128955 All targets in OG5_128955
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) phosphatidylinositol 3 Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi phosphatidylinositol kinase related protein, putative Get druggable targets OG5_128955 All targets in OG5_128955
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans potential phosphatidylinositol kinase similar to S. cerevisiae MEC1 (YBR136W) involved in DNA repair and recombination Get druggable targets OG5_128386 All targets in OG5_128386
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_128955 All targets in OG5_128955
Schistosoma japonicum hypothetical protein Get druggable targets OG5_128955 All targets in OG5_128955
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_130454 All targets in OG5_130454
Echinococcus multilocularis phosphatidylinositol 3 and 4 kinase Get druggable targets OG5_128386 All targets in OG5_128386
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_128955 All targets in OG5_128955
By sequence similarity to non orthologous known druggable targets
No druggable targets predicted by sequence similarity
Obtained from network model

Ranking Plot

Putative Targets List

Species Potential target Raw Global Species
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative 0.0144 0.3496 1
Leishmania major target of rapamycin (TOR) kinase 1, putative 0.012 0.2609 0.8582
Trichomonas vaginalis PIKK family atypical protein kinase 0.0106 0.2109 0.8084
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor1 0.012 0.2609 0.7463
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0065 0.0636 0.1142
Trypanosoma cruzi phosphatidylinositol kinase related protein, putative 0.0065 0.0636 0.1818
Toxoplasma gondii target of rapamycin (TOR), putative 0.0106 0.2109 1
Giardia lamblia GTOR 0.012 0.2609 0.5
Leishmania major target of rapamycin kinase (TOR) kinase 3 0.0109 0.2211 0.5951
Trichomonas vaginalis PIKK family atypical protein kinase 0.0109 0.221 0.847
Loa Loa (eye worm) hypothetical protein 0.0053 0.0194 0.0348
Trichomonas vaginalis PIKK family atypical protein kinase 0.012 0.2609 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0084 0.1312 0.503
Schistosoma mansoni ataxia telangiectasia mutated (atm) 0.0065 0.0636 0.1142
Echinococcus multilocularis FKBP12 rapamycin complex associated protein 0.012 0.2609 0.2609
Trichomonas vaginalis PIKK family atypical protein kinase 0.0095 0.171 0.6554
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0144 0.3496 0.6279
Echinococcus granulosus phosphatidylinositol 3 and 4 kinase 0.0144 0.3496 0.3496
Trichomonas vaginalis PIKK family atypical protein kinase 0.0069 0.0797 0.3054
Echinococcus granulosus FKBP12 rapamycin complex associated protein 0.012 0.2609 0.2609
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative 0.0144 0.3496 1
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor2 0.012 0.2609 0.7463
Trichomonas vaginalis PIKK family atypical protein kinase 0.0097 0.1778 0.6815
Toxoplasma gondii FATC domain-containing protein 0.0065 0.0636 0.2306
Schistosoma mansoni phosphatidylinositol 3-and 4-kinase 0.0144 0.3496 0.6279
Trichomonas vaginalis PIKK family atypical protein kinase 0.0095 0.1711 0.656
Entamoeba histolytica hypothetical protein 0.0065 0.0636 0.2436
Trichomonas vaginalis PIKK family atypical protein kinase 0.0069 0.0797 0.3054
Trichomonas vaginalis PIKK family atypical protein kinase 0.012 0.2609 1
Leishmania major hypothetical protein, conserved 0.0126 0.2823 1
Schistosoma mansoni serine/threonine protein kinase 0.0202 0.5567 1
Trypanosoma cruzi target of rapamycin kinase 3 0.0109 0.2211 0.6326
Trichomonas vaginalis PIKK family atypical protein kinase 0.0106 0.2109 0.8084
Trichomonas vaginalis PIKK family atypical protein kinase 0.0098 0.1812 0.6946
Trypanosoma brucei target of rapamycin kinase 3, putative 0.0109 0.2211 0.8028
Trichomonas vaginalis PIKK family atypical protein kinase 0.0109 0.221 0.847
Trichomonas vaginalis PIKK family atypical protein kinase 0.0072 0.0898 0.344
Loa Loa (eye worm) phosphatidylinositol 3 0.0097 0.1778 0.3194
Trypanosoma brucei Phosphatidylinositol 3-kinase tor1 0.012 0.2609 1
Trypanosoma brucei phosphatidylinositol 3-kinase, putative 0.0084 0.1312 0.3568
Entamoeba histolytica phosphatidylinositol3-kinaseTor2, putative 0.012 0.2609 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0109 0.221 0.847
Trichomonas vaginalis PIKK family atypical protein kinase 0.0065 0.0636 0.2436
Trichomonas vaginalis conserved hypothetical protein 0.0053 0.0194 0.0743
Schistosoma mansoni ataxia telangiectasia mutated (atm)-related 0.012 0.2609 0.4686
Trichomonas vaginalis PIKK family atypical protein kinase 0.0095 0.1711 0.656
Trichomonas vaginalis PIKK family atypical protein kinase 0.0084 0.1312 0.503
Echinococcus multilocularis serine protein kinase ATM 0.0065 0.0636 0.0636
Trypanosoma brucei phosphatidylinositol 4-kinase, putative 0.012 0.2609 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0083 0.1297 0.497
Loa Loa (eye worm) CAMK/CAMKL/CHK1 protein kinase 0.0202 0.5567 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0095 0.1711 0.656
Trichomonas vaginalis PIKK family atypical protein kinase 0.0095 0.1711 0.656
Echinococcus multilocularis DNA dependent protein kinase catalytic subunit 0.0325 1 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0069 0.0797 0.3054
Trypanosoma brucei phosphatidylinositol kinase related protein, putative 0.0065 0.0636 0.0211
Trichomonas vaginalis PIKK family atypical protein kinase 0.0084 0.1312 0.503
Leishmania major phosphatidylinositol 3-related kinase, putative 0.0097 0.1778 0.3083
Entamoeba histolytica FKBP-rapamycin associated protein (FRAP), putative 0.012 0.2609 1
Entamoeba histolytica Phosphatidylinositol 3- and 4-kinase family 0.006 0.0466 0.1786
Brugia malayi Protein kinase domain containing protein 0.0202 0.5567 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0095 0.171 0.6554
Trichomonas vaginalis PIKK family atypical protein kinase 0.0109 0.221 0.847
Trichomonas vaginalis PIKK family atypical protein kinase 0.0084 0.1312 0.503
Trypanosoma brucei phosphatidylinositol 3-related kinase, putative 0.0097 0.1778 0.5878
Trichomonas vaginalis PIKK family atypical protein kinase 0.0095 0.171 0.6554
Loa Loa (eye worm) hypothetical protein 0.0049 0.0057 0.0102
Trichomonas vaginalis PIKK family atypical protein kinase 0.0106 0.2109 0.8084
Trichomonas vaginalis PIKK family atypical protein kinase 0.006 0.0466 0.1786
Trichomonas vaginalis PIKK family atypical protein kinase 0.0106 0.2109 0.8084
Trichomonas vaginalis PIKK family atypical protein kinase 0.0078 0.1091 0.4183
Trichomonas vaginalis PIKK family atypical protein kinase 0.012 0.2609 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0106 0.2109 0.8084
Leishmania major target of rapamycin (TOR) kinase 2, putative 0.012 0.2609 0.8582
Trichomonas vaginalis PIKK family atypical protein kinase 0.0106 0.2109 0.8084
Trichomonas vaginalis PIKK family atypical protein kinase 0.0098 0.1812 0.6946
Echinococcus multilocularis phosphatidylinositol 3 and 4 kinase 0.0144 0.3496 0.3496
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.012 0.2609 0.4686
Echinococcus granulosus serine protein kinase ATM 0.0065 0.0636 0.0636
Trypanosoma cruzi phosphatidylinositol kinase related protein, putative 0.0049 0.0057 0.0162
Loa Loa (eye worm) phosphatidylinositol 3 0.012 0.2609 0.4686
Trypanosoma cruzi hypothetical protein, conserved 0.011 0.2244 0.642
Trichomonas vaginalis PIKK family atypical protein kinase 0.0109 0.221 0.847
Trichomonas vaginalis PIKK family atypical protein kinase 0.0106 0.2109 0.8084

Activities

Activity type Activity value Assay description Source Reference
IC50 (binding) = 0.001 uM Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assay ChEMBL. 25589927
IC50 (binding) = 0.16 uM Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assay ChEMBL. 25589927
IC50 (binding) > 2.3 uM Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assay ChEMBL. 25589927
IC50 (binding) = 6.5 uM Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assay ChEMBL. 25589927
IC50 (binding) = 14 uM Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assay ChEMBL. 25589927
IC50 (binding) > 30 uM Inhibition of human ERG by automated whole cell electrophysiology ChEMBL. 25589927

Phenotypes

Whole-cell/tissue/organism interactions

We have no records of whole-cell/tissue assays done with this compound What does this mean?

Many chemical entities in TDR Targets come from high-throughput screenings with whole cells or tissue samples, and not all assayed compounds have been tested against a single a single target protein, probably because they get ruled out during screening process. Even if these compounds may have not been of interest in the original screening, they may come as interesting leads for other screening assays. Furthermore, we may be able to propose drug-target associations using chemical similarities and network patterns.

Annotated phenotypes:

We have no manually annotated phenotypes for this drug. What does this mean? / Care to help?
In TDR Targets, information about phenotypes that are caused by drugs, or by genetic manipulation of cells (e.g. gene knockouts or knockdowns) is manually curated from the literature. These descriptions help to describe the potential of the target for drug development. If no information is available for this gene or if the information is incomplete, this may mean that i) the papers containing this information either appeared after the curation effort for this organism was carried out or they were inadvertently missed by curators; or that ii) the curation effort for this organism has not yet started.
 
In any case, if you have information about papers containing relevant validation data for this target, please log in using your TDR Targets username and password and send them to us using the corresponding form in this page (only visible to registered users) or contact us.

External resources for this compound

Bibliographic References

1 literature reference was collected for this gene.

If you have references for this compound, please enter them in a user comment (below) or Contact us.