Detailed information for compound 1973389
Basic information
Technical information
- Name: Unnamed compound
- MW: 390.438 | Formula: C21H22N6O2
-
H donors: 4
H acceptors: 4
LogP: 1.36
Rotable bonds: 5
Rule of 5 violations (Lipinski): 1 - SMILES: NC(=O)c1cc(cc2c1ncnc2N[C@H]1CCCNC1)c1cccc(c1)C(=O)N
- InChi: 1S/C21H22N6O2/c22-19(28)13-4-1-3-12(7-13)14-8-16(20(23)29)18-17(9-14)21(26-11-25-18)27-15-5-2-6-24-10-15/h1,3-4,7-9,11,15,24H,2,5-6,10H2,(H2,22,28)(H2,23,29)(H,25,26,27)/t15-/m0/s1
- InChiKey: YIGOVOVHNMDCGU-HNNXBMFYSA-N
Network
Hover on a compound node to display the structore
Synonyms
No synonyms found for this compound
Targets
Known targets for this compound
| Species | Target name | Source | Bibliographic reference |
|---|---|---|---|
| Homo sapiens | 3-phosphoinositide dependent protein kinase 1 | Starlite/ChEMBL | No references |
| Homo sapiens | aurora kinase A | Starlite/ChEMBL | No references |
| Homo sapiens | aurora kinase B | Starlite/ChEMBL | No references |
| Homo sapiens | ribosomal protein S6 kinase, 70kDa, polypeptide 1 | Starlite/ChEMBL | No references |
Predicted pathogen targets for this compound
By orthology
By sequence similarity to non orthologous known druggable targets
| Species | Potential target | Known druggable target | Length | Alignment span | Identity |
|---|---|---|---|---|---|
| Trypanosoma brucei | mitogen-activated protein kinase 5 | aurora kinase B | 303 aa | 299 aa | 22.1 % |
Obtained from network model
Ranking Plot
Putative Targets List
| Species | Potential target | Raw | Global | Species |
|---|---|---|---|---|
| Brugia malayi | p70 ribosomal S6 kinase beta | 0.0052 | 0.279 | 0.279 |
| Echinococcus multilocularis | rac serine:threonine kinase | 0.0035 | 0.1367 | 0.1367 |
| Echinococcus granulosus | 3-phosphoinositide-dependent protein kinase 1 | 0.006 | 0.3502 | 0.3502 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0137 | 1 | 1 |
| Schistosoma mansoni | protein kinase | 0.0137 | 1 | 1 |
| Entamoeba histolytica | protein kinase, putative | 0.0137 | 1 | 1 |
| Loa Loa (eye worm) | AUR protein kinase | 0.0137 | 1 | 1 |
| Echinococcus multilocularis | nervana 2 | 0.0033 | 0.1194 | 0.1194 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0052 | 0.279 | 0.279 |
| Schistosoma mansoni | serine/threonine protein kinase | 0.0137 | 1 | 1 |
| Toxoplasma gondii | aurora kinase | 0.0137 | 1 | 1 |
| Echinococcus granulosus | Glutaredoxin protein 5 | 0.0033 | 0.1194 | 0.1194 |
| Brugia malayi | Protein kinase domain containing protein | 0.0052 | 0.279 | 0.279 |
| Entamoeba histolytica | protein kinase 2, putative | 0.0035 | 0.1367 | 0.1367 |
| Echinococcus granulosus | serine/threonine protein kinase | 0.0035 | 0.1367 | 0.1367 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0052 | 0.279 | 0.279 |
| Echinococcus multilocularis | serine threonine protein kinase nrc serine threonine protein kinase gad | 0.0035 | 0.1367 | 0.1367 |
| Loa Loa (eye worm) | AUR protein kinase | 0.0137 | 1 | 1 |
| Brugia malayi | serine/threonine-protein kinase 6 | 0.0137 | 1 | 1 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0052 | 0.279 | 0.279 |
| Entamoeba histolytica | protein kinase, putative | 0.006 | 0.3502 | 0.3502 |
| Brugia malayi | Protein kinase domain containing protein | 0.006 | 0.3502 | 0.3502 |
| Entamoeba histolytica | PH domain containing protein kinase, putative | 0.0035 | 0.1367 | 0.1367 |
| Echinococcus multilocularis | nervana 2 | 0.0033 | 0.1194 | 0.1194 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0052 | 0.279 | 0.279 |
| Loa Loa (eye worm) | AGC/AKT protein kinase | 0.0052 | 0.279 | 0.279 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0137 | 1 | 1 |
| Schistosoma mansoni | serine/threonine-protein kinase | 0.0035 | 0.1367 | 0.1367 |
| Brugia malayi | phosphoinositide-dependent protein kinase I | 0.006 | 0.3502 | 0.3502 |
| Entamoeba histolytica | serine/threonine- protein kinase 6 , putative | 0.0137 | 1 | 1 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0052 | 0.279 | 0.279 |
| Trypanosoma cruzi | aurora B kinase, putative | 0.0137 | 1 | 1 |
| Echinococcus multilocularis | aurora kinase A | 0.0137 | 1 | 1 |
| Echinococcus granulosus | serine threonine protein kinase nrc | 0.0035 | 0.1367 | 0.1367 |
| Entamoeba histolytica | protein kinase, putative | 0.0052 | 0.279 | 0.279 |
| Entamoeba histolytica | protein kinase domain containing protein | 0.0137 | 1 | 1 |
| Trichomonas vaginalis | AGC family protein kinase | 0.006 | 0.3502 | 0.3502 |
| Entamoeba histolytica | protein kinase, putative | 0.0052 | 0.279 | 0.279 |
| Echinococcus multilocularis | Glutaredoxin protein 5 | 0.0033 | 0.1194 | 0.1194 |
| Entamoeba histolytica | serine/threonine- protein kinase 6, putative | 0.0137 | 1 | 1 |
| Plasmodium vivax | serine/threonine protein kinase 6, putative | 0.0137 | 1 | 1 |
| Giardia lamblia | Aurora kinase | 0.0137 | 1 | 1 |
| Echinococcus multilocularis | serine:threonine protein kinase 12 B | 0.0137 | 1 | 1 |
| Plasmodium falciparum | serine/threonine protein kinase, putative | 0.0137 | 1 | 1 |
| Entamoeba histolytica | serine/threonine protein kinase 6, putative | 0.0137 | 1 | 1 |
| Loa Loa (eye worm) | AGC/RSK/P70 protein kinase | 0.0052 | 0.279 | 0.279 |
| Echinococcus multilocularis | sodium:potassium dependent atpase beta subunit | 0.0033 | 0.1194 | 0.1194 |
| Trichomonas vaginalis | AGC family protein kinase | 0.006 | 0.3502 | 0.3502 |
| Entamoeba histolytica | protein kinase, putative | 0.0052 | 0.279 | 0.279 |
| Echinococcus granulosus | serine:threonine protein kinase 12 B | 0.0137 | 1 | 1 |
| Leishmania major | protein kinase, putative | 0.0137 | 1 | 0.5 |
| Entamoeba histolytica | PH domain containing protein kinase, putative | 0.0035 | 0.1367 | 0.1367 |
| Echinococcus granulosus | nervana 2 | 0.0033 | 0.1194 | 0.1194 |
| Echinococcus granulosus | sodium:potassium dependent atpase beta subunit | 0.0033 | 0.1194 | 0.1194 |
| Loa Loa (eye worm) | AUR protein kinase | 0.0137 | 1 | 1 |
| Brugia malayi | serine/threonine kinase 12 | 0.0137 | 1 | 1 |
| Trichomonas vaginalis | AGC family protein kinase | 0.006 | 0.3502 | 0.3502 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0052 | 0.279 | 0.279 |
| Entamoeba histolytica | protein kinase, putative | 0.0137 | 1 | 1 |
| Echinococcus granulosus | aurora kinase A | 0.0137 | 1 | 1 |
| Schistosoma mansoni | serine/threonine-protein kinase | 0.0035 | 0.1367 | 0.1367 |
| Loa Loa (eye worm) | AGC/PDK1 protein kinase | 0.006 | 0.3502 | 0.3502 |
| Loa Loa (eye worm) | AGC/PDK1 protein kinase | 0.006 | 0.3502 | 0.3502 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0137 | 1 | 1 |
| Echinococcus granulosus | calcium:calmodulin dependent protein kinase | 0.0035 | 0.1367 | 0.1367 |
| Echinococcus granulosus | nervana 2 | 0.0033 | 0.1194 | 0.1194 |
| Echinococcus multilocularis | 3 phosphoinositide dependent protein kinase 1 | 0.006 | 0.3502 | 0.3502 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0052 | 0.279 | 0.279 |
| Entamoeba histolytica | protein kinase , putative | 0.0137 | 1 | 1 |
| Trypanosoma brucei | aurora B kinase | 0.0137 | 1 | 1 |
| Schistosoma mansoni | serine/threonine protein kinase | 0.006 | 0.3502 | 0.3502 |
| Trichomonas vaginalis | AGC family protein kinase | 0.0137 | 1 | 1 |
Activities
| Activity type | Activity value | Assay description | Source | Reference |
|---|---|---|---|---|
| IC50 (binding) | = 110 nM | BindingDB_Patents: Enzyme Assay. The Aurora assays described here are performed on two Caliper Life Sciences systems: the LC3000 and the Desktop Profiler. These provide data on enzyme activity via measurement of the relative amounts of phosphorylated or unphosphorylated fluorescently labelled substrate peptide at the end of an enzymatic reaction. These different states of peptide are resolved by applying a potential difference across the sample. The presence of the charged phosphate group on the product (as opposed to the substrate) causes a different peptide mobility between the two peptides. This is visualized by excitation of the fluorescent label on the substrate and product peptides and represented as peaks within the analysis software. | ChEMBL. | No reference |
| IC50 (binding) | = 390 nM | BindingDB_Patents: Enzyme Assay. The kinase assay is performed as 384-well Flashplate assay (PerkinElmer LAS Germany GmbH). 3.4 nM His6-PDK1(Delta 1-50) (PDK1 that has a His-tag consisting of six histidines and lacks the first fifty amino acids), 400 nM PDKtide (Biotin-bA-bAKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as the substrate, and 4 µM ATP (spiked with 0.25 µCi 33P-ATP/well) are incubated in a total volume of 50 µl (50 mM TRIS, 10 mM Mg-acetate, 0.1% Mercaptoethanol, 0.02 Brij35, 0.1% BSA, pH 7.5) with or without test compound (5-10 concentrations) for 60 Min at 30° C. The reaction is stopped with 25 µl 200 mM EDTA. After 30 Min at room temperature the liquid is removed and each well washed thrice with 100 ml 0.9% sodium chloride solution. Nonspecific reaction is determined in presence of 100 nM of the high affinity protein kinase inhibitor Staurosporine. Radioactivity is measured in a Topcount (PerkinElmer LAS Germany GmbH). | ChEMBL. | No reference |
| IC50 (binding) | = 390 nM | BindingDB_Patents: Enzyme Assay. The kinase assay is performed as 384-well Flashplate assay (PerkinElmer LAS Germany GmbH). 3.4 nM His6-PDK1(Delta 1-50) (PDK1 that has a His-tag consisting of six histidines and lacks the first fifty amino acids), 400 nM PDKtide (Biotin-bA-bAKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as the substrate, and 4 µM ATP (spiked with 0.25 µCi 33P-ATP/well) are incubated in a total volume of 50 µl (50 mM TRIS, 10 mM Mg-acetate, 0.1% Mercaptoethanol, 0.02 Brij35, 0.1% BSA, pH 7.5) with or without test compound (5-10 concentrations) for 60 Min at 30° C. The reaction is stopped with 25 µl 200 mM EDTA. After 30 Min at room temperature the liquid is removed and each well washed thrice with 100 ml 0.9% sodium chloride solution. Nonspecific reaction is determined in presence of 100 nM of the high affinity protein kinase inhibitor Staurosporine. Radioactivity is measured in a Topcount (PerkinElmer LAS Germany GmbH). | ChEMBL. | No reference |
| IC50 (binding) | = 740 nM | Enzyme Assay | BINDINGDB. | No reference |
| IC50 (binding) | = 10000 nM | BindingDB_Patents: Enzyme Assay. P70S6K inhibitor compounds are diluted and plated in 96 well plates. A reaction mixture including the following components is then added to the compound plate to initiate the enzyme reaction; P70S6K (3 nM, T412E mutant, Millipore) is mixed with 24 µM ATP in an assay buffer containing 100 mM Hepes (pH 7.5), 5 mM MgCl2, 1 mM DTT, 0.015% Brij and 1 µM of the substrate peptide FITC-AHA-AKRRRLSSLRA-OH (derived from the S6 ribosomal protein sequence, FITC=fluorescein isothiocyanate, AHA=6-aminohexanoic acid). The reaction is incubated for 90 min at 25° C., before the addition of 10 mM EDTA to stop the reaction. The proportion of substrate and product (phosphorylated) peptide is analysed on a Caliper Life Sciences Lab Chip 3000, using a pressure of -1.4 psi, and upstream and downstream voltages of -3000 and -700 respectively. | ChEMBL. | No reference |
| IC50 (binding) | = 10000 nM | BindingDB_Patents: Enzyme Assay. P70S6K inhibitor compounds are diluted and plated in 96 well plates. A reaction mixture including the following components is then added to the compound plate to initiate the enzyme reaction; P70S6K (3 nM, T412E mutant, Millipore) is mixed with 24 µM ATP in an assay buffer containing 100 mM Hepes (pH 7.5), 5 mM MgCl2, 1 mM DTT, 0.015% Brij and 1 µM of the substrate peptide FITC-AHA-AKRRRLSSLRA-OH (derived from the S6 ribosomal protein sequence, FITC=fluorescein isothiocyanate, AHA=6-aminohexanoic acid). The reaction is incubated for 90 min at 25° C., before the addition of 10 mM EDTA to stop the reaction. The proportion of substrate and product (phosphorylated) peptide is analysed on a Caliper Life Sciences Lab Chip 3000, using a pressure of -1.4 psi, and upstream and downstream voltages of -3000 and -700 respectively. | ChEMBL. | No reference |
Phenotypes
Whole-cell/tissue/organism interactions
We have no records of whole-cell/tissue assays done with this compound
What does this mean?
Many chemical entities in TDR Targets come from high-throughput screenings with whole cells or tissue samples, and not all assayed compounds have been tested against a single a single target protein, probably because they get ruled out during screening process. Even if these compounds may have not been of interest in the original screening, they may come as interesting leads for other screening assays. Furthermore, we may be able to propose drug-target associations using chemical similarities and network patterns.
Annotated phenotypes:
We have no manually annotated phenotypes for this drug.
What does this mean? / Care to help?
In TDR Targets, information about phenotypes that are caused by
drugs, or by genetic manipulation of cells (e.g. gene knockouts or
knockdowns) is manually curated from the literature. These
descriptions help to describe the potential of the target for drug
development. If no information is available for this gene or if the
information is incomplete, this may mean that i) the papers
containing this information either appeared after the curation
effort for this organism was carried out or they were inadvertently
missed by curators; or that ii) the curation effort for this
organism has not yet started.
In any case, if you have information about papers containing relevant validation data for this target, please log in using your TDR Targets username and password and send them to us using the corresponding form in this page (only visible to registered users) or contact us.
In any case, if you have information about papers containing relevant validation data for this target, please log in using your TDR Targets username and password and send them to us using the corresponding form in this page (only visible to registered users) or contact us.
External resources for this compound
- ChEMBL: CHEMBL3685320
Bibliographic References
No literature references available for this target.
If you have references for this compound, please enter them in a user comment (below) or Contact us.