Detailed information for compound 1601524

Basic information

Technical information
  • Name: Unnamed compound
  • MW: 460.507 | Formula: C24H25FN8O
  • H donors: 3 H acceptors: 5 LogP: 2.22 Rotable bonds: 6
    Rule of 5 violations (Lipinski): 1
  • SMILES: Fc1ccc(cc1)[C@H]1NCC[C@H]1Nc1cncc(n1)C(=O)c1cn(c2c1c(N)ncn2)C(C)C
  • InChi: 1S/C24H25FN8O/c1-13(2)33-11-16(20-23(26)29-12-30-24(20)33)22(34)18-9-27-10-19(32-18)31-17-7-8-28-21(17)14-3-5-15(25)6-4-14/h3-6,9-13,17,21,28H,7-8H2,1-2H3,(H,31,32)(H2,26,29,30)/t17-,21-/m1/s1
  • InChiKey: BPVKBARHCLRGKI-DYESRHJHSA-N  


Substructure search Similarity search

Network

Hover on a compound node to display the structore

Synonyms

No synonyms found for this compound

Targets

Known targets for this compound

Species Target name Source Bibliographic reference
Homo sapiens 3-phosphoinositide dependent protein kinase 1 Starlite/ChEMBL References
Homo sapiens mechanistic target of rapamycin (serine/threonine kinase) Starlite/ChEMBL References
Mus musculus phosphatidylinositol 3-kinase, catalytic, alpha polypeptide Starlite/ChEMBL References
Homo sapiens v-akt murine thymoma viral oncogene homolog 1 Starlite/ChEMBL References

Predicted pathogen targets for this compound

By orthology
Species Potential target Known druggable target/s Ortholog Group
Trypanosoma brucei Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus Glutaredoxin protein 5 Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma cruzi Protein kinase B Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica hypothetical protein Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma congolense Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Toxoplasma gondii target of rapamycin (TOR), putative Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans similar to internal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in n Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus serine threonine protein kinase nrc Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_128785 All targets in OG5_128785
Brugia malayi p70 ribosomal S6 kinase beta Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma brucei gambiense phosphatidylinositol 3 kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum ko:K06276 3-phosphoinositide dependent protein kinase-1, putative Get druggable targets OG5_128785 All targets in OG5_128785
Plasmodium knowlesi RAC-beta serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum ko:K08792 serum/glucocorticoid regulated kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Leishmania infantum target of rapamycin (TOR) kinase 1, putative Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica FKBP-rapamycin associated protein (FRAP), putative Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis FKBP12 rapamycin complex associated protein Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania mexicana phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K Get druggable targets OG5_127444 All targets in OG5_127444
Entamoeba histolytica phosphatidylinositol3-kinaseTor2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus phosphatidylinositol 45 bisphosphate 3 kinase Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trypanosoma congolense rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum ko:K07203 FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma congolense Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Neospora caninum Phosphatidylinositol 3-kinase tor2, related Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica PH domain containing protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Loa Loa (eye worm) AGC/RSK/P70 protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium falciparum RAC-beta serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis phopsphatidylinositol 3-kinase, drosophila, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Entamoeba histolytica phosphatidylinositol 3-kinase 1, putative Get druggable targets OG5_127444 All targets in OG5_127444
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania donovani Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis serine threonine protein kinase nrc serine threonine protein kinase gad Get druggable targets OG5_126635 All targets in OG5_126635
Loa Loa (eye worm) phosphatidylinositol 3 Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis phosphatidylinositol 4,5 bisphosphate 3 kinase Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis Glutaredoxin protein 5 Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium yoelii kinase Akt/PKB-related Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus multilocularis nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Loa Loa (eye worm) AGC/AKT protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania donovani Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans frameshifted from upstream TOR2 CDS (CaP19.1905) Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_128785 All targets in OG5_128785
Leishmania infantum target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania braziliensis target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma mansoni serine/threonine-protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans similar to S. cerevisiae protein kinases PKH1 (YDR490C) and PKH2 (YOL100W) involved in MAPKKK cascade Get druggable targets OG5_128785 All targets in OG5_128785
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania infantum phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trypanosoma brucei gambiense rac serine-threonine kinase, putative,protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania mexicana phosphatidylinositol 3 kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis sodium:potassium dependent atpase beta subunit Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus 3-phosphoinositide-dependent protein kinase 1 Get druggable targets OG5_128785 All targets in OG5_128785
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans similar to N terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) putative protein/phosphatidylinositol kinases in Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania major target of rapamycin (TOR) kinase 1, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Toxoplasma gondii AGC kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma cruzi rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis 3 phosphoinositide dependent protein kinase 1 Get druggable targets OG5_128785 All targets in OG5_128785
Brugia malayi phosphoinositide-dependent protein kinase I Get druggable targets OG5_128785 All targets in OG5_128785
Plasmodium vivax rac-beta serine/threonine protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania donovani phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus granulosus calcium:calmodulin dependent protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trypanosoma brucei phosphatidylinositol 3-kinase tor, putative Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) phosphatidylinositol 3 Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma brucei gambiense phosphatidylinositol 3-kinase tor, putative Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Giardia lamblia GTOR Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum ko:K04456 RAC serine/threonine-protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Neospora caninum Ribosomal protein S6 kinase alpha-6 (EC 2.7.11.1), related Get druggable targets OG5_126635 All targets in OG5_126635
Loa Loa (eye worm) AGC/PDK1 protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Trichomonas vaginalis phosphatidylinositol kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Schistosoma japonicum ko:K07390 monothiol glutaredoxin, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium berghei rac-beta serine/threonine protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei phosphatidylinositol 4-kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans frameshifted from upsteam TOR2 CDS (CaP19.9461) Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Giardia lamblia Kinase, AGC PKA Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus sodium:potassium dependent atpase beta subunit Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum Sodium/potassium-transporting ATPase subunit beta-1, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma mansoni serine/threonine-protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans likely protein kinase similar to S. cerevisiae YPK2 (YMR104C) Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma brucei rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans similar to N terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) putative protein/phosphatidylinositol kinases in Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis rac serine:threonine kinase Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) AGC/PDK1 protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Schistosoma japonicum ko:K00922 phosphatidylinositol-4,5-bisphosphate 3-kinase [EC2.7.1.153], putative Get druggable targets OG5_127444 All targets in OG5_127444
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma mansoni ataxia telangiectasia mutated (atm)-related Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania major target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica PH domain containing protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica protein kinase 2, putative Get druggable targets OG5_126635 All targets in OG5_126635
Giardia lamblia Phosphoinositide-3-kinase, catalytic, alpha polypeptide Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum RAC serine/threonine-protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans similar to internal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in n Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus FKBP12 rapamycin complex associated protein Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit gamma, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans similar to S. cerevisiae protein kinases PKH1 (YDR490C) and PKH2 (YOL100W) involved in MAPKKK cascade Get druggable targets OG5_128785 All targets in OG5_128785
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania mexicana phosphatidylinositol 3-kinase (tor2)-like protein Get druggable targets OG5_127212 All targets in OG5_127212
By sequence similarity to non orthologous known druggable targets
Species Potential target Known druggable target Length Alignment span Identity
Entamoeba histolytica phosphatidylinositol 3-kinase, putative phosphatidylinositol 3-kinase, catalytic, alpha polypeptide 1068 aa 927 aa 29.0 %
Obtained from network model

Ranking Plot

Putative Targets List

Species Potential target Raw Global Species
Echinococcus granulosus p21 activated protein kinase 1 Dpak1 0.0498 0.0843 0.092
Trichomonas vaginalis AGC family protein kinase 0.005 0.0057 0.0672
Mycobacterium ulcerans long-chain-fatty-acid-CoA ligase 0.0025 0.0013 1
Schistosoma mansoni serine/threonine protein kinase 0.0023 0.0009 0.0087
Trypanosoma cruzi rac serine-threonine kinase, putative 0.0035 0.003 0.1584
Loa Loa (eye worm) GTP-binding regulatory protein Gs alpha-S chain 0.0046 0.005 0.0048
Echinococcus granulosus nervana 2 0.0025 0.0012 0.0011
Mycobacterium ulcerans long-chain-fatty-acid--CoA ligase 0.0025 0.0013 1
Schistosoma mansoni protein kinase 0.0498 0.0843 1
Echinococcus multilocularis serine threonine protein kinase 0.0023 0.0009 0.0008
Echinococcus granulosus serine:threonine protein kinase PAK 4 0.5226 0.9144 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0051 0.0596
Entamoeba histolytica protein kinase, putative 0.05 0.0847 1
Treponema pallidum exodeoxyribonuclease (exoA) 0.002 0.0004 0.5
Mycobacterium tuberculosis Probable exodeoxyribonuclease III protein XthA (exonuclease III) (EXO III) (AP endonuclease VI) 0.002 0.0004 0.2958
Plasmodium vivax rac-beta serine/threonine protein kinase, putative 0.0035 0.003 1
Brugia malayi Protein kinase domain containing protein 0.005 0.0057 0.0055
Brugia malayi WH1 domain containing protein 0.0488 0.0825 0.0823
Entamoeba histolytica hypothetical protein 0.0488 0.0825 0.9732
Trichomonas vaginalis STE family protein kinase 0.0498 0.0843 1
Entamoeba histolytica protein kinase, putative 0.0023 0.0009 0.0086
Trypanosoma brucei Phosphatidylinositol 3-kinase tor1 0.0058 0.007 1
Leishmania major apurinic/apyrimidinic endonuclease-redox protein 0.002 0.0004 0.0296
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor1 0.0058 0.007 0.3778
Schistosoma mansoni protein kinase 0.0498 0.0843 1
Schistosoma mansoni hypothetical protein 0.0488 0.0825 0.9782
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.007 0.0827
Echinococcus granulosus NDR protein kinase 0.0023 0.0009 0.0008
Schistosoma mansoni hypothetical protein 0.0035 0.0029 0.0326
Loa Loa (eye worm) hypothetical protein 0.0035 0.0029 0.0027
Entamoeba histolytica phosphatidylinositol 3-kinase 1, putative 0.0115 0.017 0.199
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0046 0.0538
Echinococcus multilocularis 3 phosphoinositide dependent protein kinase 1 0.0069 0.0089 0.0096
Trypanosoma cruzi apurinic/apyrimidinic endonuclease, putative 0.002 0.0004 0.0112
Trichomonas vaginalis PIKK family atypical protein kinase 0.005 0.0056 0.0662
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0019 0.0002 0.0018
Trichomonas vaginalis AGC family protein kinase 0.005 0.0057 0.0672
Echinococcus granulosus 3-phosphoinositide-dependent protein kinase 1 0.0069 0.0089 0.0096
Schistosoma mansoni serine/threonine protein kinase 0.0023 0.0009 0.0087
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0007 0.0076
Trichomonas vaginalis PIKK family atypical protein kinase 0.0039 0.0037 0.0431
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K 0.0043 0.0044 0.0504
Entamoeba histolytica exodeoxyribonuclease III, putative 0.002 0.0004 0.0024
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0043 0.0044 0.0042
Echinococcus granulosus serine:threonine protein kinase N2 0.0023 0.0009 0.0008
Echinococcus multilocularis neural Wiskott Aldrich syndrome protein 0.0488 0.0825 0.09
Brugia malayi exodeoxyribonuclease III family protein 0.002 0.0004 0.0002
Trichomonas vaginalis AGC family protein kinase 0.0026 0.0013 0.0156
Loa Loa (eye worm) P21-Rho-binding domain-containing protein 0.0488 0.0825 0.0823
Trichomonas vaginalis AGC family protein kinase 0.005 0.0057 0.0672
Schistosoma mansoni atypical protein kinase C 0.0023 0.0009 0.0087
Brugia malayi P21-Rho-binding domain containing protein 0.0488 0.0825 0.0823
Brugia malayi Protein kinase domain containing protein 0.0023 0.0009 0.0007
Leishmania major phosphatidylinositol 3-kinase, putative 0.0022 0.0007 0.0719
Brugia malayi p70 ribosomal S6 kinase beta 0.0048 0.0053 0.0051
Trypanosoma brucei phosphatidylinositol 3-kinase tor, putative 0.0029 0.002 0.264
Echinococcus multilocularis FKBP12 rapamycin complex associated protein 0.0058 0.007 0.0075
Trypanosoma cruzi phosphatidylinositol 3-kinase vps34-like 0.0043 0.0044 0.2348
Plasmodium falciparum AP endonuclease (DNA-[apurinic or apyrimidinic site] lyase), putative 0.002 0.0004 0.0714
Giardia lamblia Kinase, AGC PKA 0.0035 0.003 0.0317
Echinococcus granulosus serine:threonine protein kinase PAK 3 0.0498 0.0843 0.092
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K 0.0226 0.0365 0.4321
Entamoeba histolytica acyl-CoA synthetase, putative 0.0025 0.0013 0.0132
Trypanosoma cruzi apurinic/apyrimidinic endonuclease 0.002 0.0004 0.0112
Entamoeba histolytica protein kinase, putative 0.005 0.0057 0.0652
Trypanosoma brucei phosphatidylinositol 3-kinase, putative 0.0043 0.0044 0.6215
Schistosoma mansoni serine/threonine protein kinase 0.0023 0.0009 0.0087
Brugia malayi latrophilin 2 splice variant baaae 0.0035 0.0029 0.0027
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0026 0.0306
Echinococcus multilocularis protein kinase c epsilon type 0.0023 0.0009 0.0008
Brugia malayi Protein kinase domain containing protein 0.0069 0.0089 0.0087
Loa Loa (eye worm) hypothetical protein 0.008 0.0109 0.0107
Echinococcus granulosus PAK box P21 Rho binding 0.0488 0.0825 0.09
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0122 0.0182 0.2161
Trypanosoma cruzi Protein kinase B 0.0038 0.0035 0.1824
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0007 0.0076
Mycobacterium tuberculosis Probable fatty-acid-CoA ligase FadD2 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase) 0.0025 0.0013 1
Plasmodium falciparum phosphatidylinositol 3-kinase 0.0019 0.0002 0.0009
Brugia malayi P21-Rho-binding domain containing protein 0.0488 0.0825 0.0823
Echinococcus multilocularis ribosomal protein s6 kinase beta 1 0.0023 0.0009 0.0008
Echinococcus multilocularis atpase aaa+ type core atpase aaa type core 0.0865 0.1487 0.1625
Toxoplasma gondii target of rapamycin (TOR), putative 0.0044 0.0046 0.8631
Entamoeba histolytica FKBP-rapamycin associated protein (FRAP), putative 0.0058 0.007 0.0807
Plasmodium vivax AP endonuclease (DNA-[apurinic or apyrimidinic site] lyase), putative 0.002 0.0004 0.0714
Schistosoma mansoni ataxia telangiectasia mutated (atm)-related 0.0058 0.007 0.0811
Entamoeba histolytica hypothetical protein 0.0075 0.01 0.1161
Brugia malayi Corticotropin releasing factor receptor 2 precursor, putative 0.005 0.0057 0.0055
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0026 0.0307
Schistosoma mansoni protein kinase 0.0488 0.0825 0.9782
Trypanosoma brucei target of rapamycin kinase 3, putative 0.0047 0.0051 0.7154
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0019 0.0002 0.0018
Schistosoma mansoni ap endonuclease 0.002 0.0004 0.0024
Loa Loa (eye worm) hypothetical protein 0.0306 0.0506 0.0504
Schistosoma mansoni serine/threonine protein kinase 0.0023 0.0009 0.0087
Trypanosoma brucei phosphatidylinositol 3-related kinase, putative 0.0022 0.0007 0.0719
Echinococcus multilocularis ribosomal protein S6 kinase alpha 3 0.0023 0.0009 0.0008
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0026 0.0307
Echinococcus granulosus protein kinase C gamma type 0.0023 0.0009 0.0008
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0026 0.0307
Brugia malayi Protein kinase domain containing protein 0.0023 0.0009 0.0007
Mycobacterium ulcerans exodeoxyribonuclease III protein XthA 0.002 0.0004 0.1822
Echinococcus granulosus Protein kinase C brain isozyme 0.0023 0.0009 0.0008
Giardia lamblia Phosphoinositide-3-kinase, class 3 0.0031 0.0023 0.0232
Echinococcus multilocularis protein kinase c iota type 0.0023 0.0009 0.0008
Plasmodium vivax phosphatidylinositol 3-kinase, putative 0.0019 0.0002 0.0009
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative 0.0022 0.0007 0.0272
Trypanosoma cruzi rac serine-threonine kinase, putative 0.0038 0.0035 0.1824
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0046 0.0538
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0043 0.0044 0.0521
Loa Loa (eye worm) AGC/AKT protein kinase 0.005 0.0057 0.0055
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0032 0.0372
Entamoeba histolytica protein kinase 2, putative 0.0035 0.003 0.0338
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0026 0.0306
Trichomonas vaginalis AGC family protein kinase 0.0023 0.0009 0.0104
Trichomonas vaginalis ap endonuclease, putative 0.002 0.0004 0.0042
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0031 0.0366
Entamoeba histolytica protein kinase, putative 0.0498 0.0843 0.9949
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0051 0.0596
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0051 0.0596
Mycobacterium leprae PROBABLE FATTY-ACID-CoA LIGASE FADD7 (FATTY-ACID-CoA SYNTHETASE) (FATTY-ACID-CoA SYNTHASE) 0.0025 0.0013 0.5
Trichomonas vaginalis AGC family protein kinase 0.005 0.0057 0.0672
Echinococcus granulosus Basic leucine zipper bZIP transcription 0.0075 0.01 0.0107
Loa Loa (eye worm) AGC/DMPK/GEK protein kinase 0.0023 0.0009 0.0007
Giardia lamblia Kinase, STE STE20 0.0498 0.0843 1
Echinococcus granulosus protein kinase c iota type 0.0023 0.0009 0.0008
Brugia malayi Calcitonin receptor-like protein seb-1 0.005 0.0057 0.0055
Schistosoma mansoni protein kinase 0.0498 0.0843 1
Brugia malayi phosphoinositide-dependent protein kinase I 0.0069 0.0089 0.0087
Echinococcus granulosus phosphatidylinositol 45 bisphosphate 3 kinase 0.0226 0.0365 0.0398
Loa Loa (eye worm) hypothetical protein 0.005 0.0057 0.0055
Schistosoma mansoni hypothetical protein 0.0488 0.0825 0.9782
Trichomonas vaginalis ap endonuclease, putative 0.002 0.0004 0.0042
Loa Loa (eye worm) phosphatidylinositol 4-kinase type 3 alpha isoform 1 0.0019 0.0002 0.0000026469
Trichomonas vaginalis STE family protein kinase 0.0498 0.0843 1
Loa Loa (eye worm) hypothetical protein 0.0025 0.0013 0.0011
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0046 0.0538
Brugia malayi Hr1 repeat family protein 0.0023 0.0009 0.0007
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0046 0.0538
Schistosoma mansoni Guanine nucleotide-binding protein G(s) subunit alpha (Adenylate cyclase-stimulating G alpha protein) 0.0046 0.005 0.0572
Loa Loa (eye worm) AGC/PDK1 protein kinase 0.0069 0.0089 0.0087
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative 0.0085 0.0117 0.1389
Mycobacterium ulcerans acyl-CoA synthetase 0.0025 0.0013 1
Loa Loa (eye worm) AGC/NDR protein kinase 0.0023 0.0009 0.0007
Trypanosoma cruzi phosphatidylinositol 3-kinase, putative 0.0036 0.0032 0.1668
Echinococcus granulosus serine/threonine protein kinase 0.0038 0.0035 0.0036
Loa Loa (eye worm) STE/STE20/PAKB protein kinase 0.5713 1 1
Entamoeba histolytica protein kinase, putative 0.0069 0.0089 0.1034
Brugia malayi hypothetical protein 0.0075 0.01 0.0098
Echinococcus granulosus Glutaredoxin protein 5 0.0025 0.0012 0.0011
Echinococcus multilocularis serine:threonine protein kinase PAK 4 0.5226 0.9144 1
Echinococcus granulosus phosphatidylinositol 3 and 4 kinase 0.0022 0.0007 0.0005
Echinococcus multilocularis Ribosomal protein S6 kinase beta 2 0.0023 0.0009 0.0008
Echinococcus multilocularis guanine nucleotide binding protein G(s) subunit 0.0046 0.005 0.0053
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative 0.0022 0.0007 0.0272
Loa Loa (eye worm) AGC/RSK/P70 protein kinase 0.0048 0.0053 0.0051
Echinococcus granulosus guanine nucleotide binding protein Gs subunit 0.0046 0.005 0.0053
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0043 0.0044 0.0521
Schistosoma mansoni Guanine nucleotide-binding protein G(s) subunit alpha (Adenylate cyclase-stimulating G alpha protein) 0.0046 0.005 0.0572
Loa Loa (eye worm) AGC/RSK/RSK protein kinase 0.0023 0.0009 0.0007
Trichomonas vaginalis AGC family protein kinase 0.0023 0.0009 0.0104
Entamoeba histolytica protein kinase, putative 0.0048 0.0053 0.06
Echinococcus granulosus calcium:calmodulin dependent protein kinase 0.0035 0.003 0.0031
Brugia malayi GTP-binding regulatory protein Gs alpha-S chain, putative 0.0046 0.005 0.0048
Schistosoma mansoni Guanine nucleotide-binding protein G(s) subunit alpha (Adenylate cyclase-stimulating G alpha protein) 0.0046 0.005 0.0572
Echinococcus multilocularis serine:threonine protein kinase PAK 3 0.0498 0.0843 0.092
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit gamma, putative 0.0122 0.0182 0.2161
Trichomonas vaginalis AGC family protein kinase 0.0069 0.0089 0.1055
Entamoeba histolytica acyl-CoA synthetase, putative 0.0025 0.0013 0.0132
Wolbachia endosymbiont of Brugia malayi exonuclease III 0.002 0.0004 0.5
Schistosoma mansoni tyrosine kinase 0.0488 0.0825 0.9782
Trypanosoma brucei FAT domain/Rapamycin binding domain/Phosphatidylinositol 3- and 4-kinase, putative 0.0026 0.0014 0.1836
Loa Loa (eye worm) phosphatidylinositol 3 0.0036 0.0032 0.003
Echinococcus granulosus 3'partial|serine:threonine protein kinase PAK 2 0.0488 0.0825 0.09
Toxoplasma gondii exonuclease III APE 0.002 0.0004 0.0397
Echinococcus granulosus ribosomal protein S6 kinase alpha 3 0.0023 0.0009 0.0008
Echinococcus multilocularis sodium:potassium dependent atpase beta subunit 0.0025 0.0012 0.0011
Echinococcus granulosus Ribosomal protein S6 kinase beta 2 0.0023 0.0009 0.0008
Trypanosoma brucei apurinic/apyrimidinic endonuclease, putative 0.002 0.0004 0.0296
Loa Loa (eye worm) AGC/PKN protein kinase 0.0023 0.0009 0.0007
Echinococcus multilocularis phosphatidylinositol 4 phosphate 3 kinase C2 0.008 0.0109 0.0118
Entamoeba histolytica hypothetical protein 0.0075 0.01 0.1161
Mycobacterium tuberculosis Probable chain -fatty-acid-CoA ligase FadD13 (fatty-acyl-CoA synthetase) 0.0025 0.0013 1
Echinococcus granulosus FKBP12 rapamycin complex associated protein 0.0058 0.007 0.0075
Loa Loa (eye worm) hypothetical protein 0.0023 0.0009 0.0007
Loa Loa (eye worm) hypothetical protein 0.0025 0.0013 0.0011
Trypanosoma brucei rac serine-threonine kinase, putative 0.005 0.0057 0.8078
Loa Loa (eye worm) pigment dispersing factor receptor c 0.005 0.0057 0.0055
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0007 0.0076
Loa Loa (eye worm) phosphatidylinositol 3 0.0058 0.007 0.0068
Schistosoma mansoni hypothetical protein 0.0075 0.01 0.1167
Mycobacterium ulcerans fatty-acid-CoA ligase 0.0025 0.0013 1
Entamoeba histolytica hypothetical protein 0.0098 0.014 0.1634
Echinococcus granulosus protein kinase c epsilon type 0.0023 0.0009 0.0008
Echinococcus multilocularis PAK box P21 Rho binding 0.0488 0.0825 0.09
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor2 0.0058 0.007 0.3778
Entamoeba histolytica hypothetical protein 0.0075 0.01 0.1161
Brugia malayi protein kinase C II. 0.0023 0.0009 0.0007
Echinococcus multilocularis serine threonine protein kinase nrc serine threonine protein kinase gad 0.0035 0.003 0.0031
Trichomonas vaginalis conserved hypothetical protein 0.0488 0.0825 0.9782
Loa Loa (eye worm) phosphatidylinositol 3 0.0202 0.0323 0.0321
Loa Loa (eye worm) hypothetical protein 0.0488 0.0825 0.0823
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0026 0.0307
Giardia lamblia Phosphoinositide-3-kinase, catalytic, alpha polypeptide 0.0061 0.0075 0.0848
Leishmania major 4-coumarate:coa ligase-like protein 0.0025 0.0013 0.1641
Brugia malayi AMP-binding enzyme family protein 0.0025 0.0013 0.0011
Trichomonas vaginalis AGC family protein kinase 0.0023 0.0009 0.0104
Echinococcus multilocularis rac serine:threonine kinase 0.0038 0.0035 0.0036
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0043 0.0044 0.0502
Leishmania major target of rapamycin (TOR) kinase 1, putative 0.0058 0.007 1
Echinococcus granulosus serine:threonine protein kinase PAK 3 0.0498 0.0843 0.092
Echinococcus granulosus neural Wiskott Aldrich syndrome protein 0.0488 0.0825 0.09
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0122 0.0182 0.2136
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.007 0.0827
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.008 0.0109 0.0107
Trichomonas vaginalis AGC family protein kinase 0.005 0.0057 0.0672
Schistosoma mansoni wiskott-aldrich syndrome protein 0.0488 0.0825 0.9782
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0026 0.0306
Schistosoma mansoni serine/threonine protein kinase 0.0023 0.0009 0.0087
Leishmania major target of rapamycin kinase (TOR) kinase 3 0.0047 0.0051 0.7154
Entamoeba histolytica protein kinase, putative 0.005 0.0057 0.0652
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0022 0.0007 0.0005
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0031 0.0366
Mycobacterium ulcerans hypothetical protein 0.0025 0.0013 1
Loa Loa (eye worm) phosphatidylinositol 3 0.0022 0.0007 0.0005
Trichomonas vaginalis AGC family protein kinase 0.005 0.0057 0.0672
Leishmania major 4-coumarate:coa ligase-like protein 0.0025 0.0013 0.1641
Echinococcus multilocularis serine:threonine protein kinase PAK 3 0.0498 0.0843 0.092
Schistosoma mansoni serine/threonine kinase 0.0023 0.0009 0.0087
Echinococcus granulosus guanine nucleotide binding protein Gs subunit 0.0046 0.005 0.0053
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0098 0.014 0.1634
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0046 0.0538
Trichomonas vaginalis phopsphatidylinositol 3-kinase, drosophila, putative 0.0122 0.0182 0.2161
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0051 0.0596
Entamoeba histolytica PH domain containing protein kinase, putative 0.0038 0.0035 0.039
Mycobacterium leprae PROBABLE FATTY-ACID-CoA LIGASE FADD2 (FATTY-ACID-CoA SYNTHETASE) (FATTY-ACID-CoA SYNTHASE) 0.0025 0.0013 0.5
Entamoeba histolytica protein kinase, putative 0.05 0.0847 1
Echinococcus multilocularis PAK box P21 Rho binding 0.0498 0.0843 0.092
Trypanosoma cruzi target of rapamycin kinase 3 0.0047 0.0051 0.2703
Entamoeba histolytica phosphatidylinositol3-kinaseTor2, putative 0.0058 0.007 0.0807
Loa Loa (eye worm) exodeoxyribonuclease III family protein 0.002 0.0004 0.0002
Schistosoma mansoni ap endonuclease 0.002 0.0004 0.0024
Echinococcus multilocularis phosphatidylinositol 3 and 4 kinase 0.0022 0.0007 0.0005
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative 0.0043 0.0044 0.0521
Mycobacterium ulcerans long-chain fatty-acid CoA ligase 0.0025 0.0013 1
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative 0.0122 0.0182 1
Echinococcus granulosus serine threonine protein kinase nrc 0.0035 0.003 0.0031
Schistosoma mansoni serine/threonine-protein kinase 0.0038 0.0035 0.0392
Schistosoma mansoni serine/threonine protein kinase 0.0023 0.0009 0.0087
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0032 0.0372
Trichomonas vaginalis STE family protein kinase 0.0498 0.0843 1
Echinococcus granulosus nervana 2 0.0025 0.0012 0.0011
Echinococcus granulosus DNA apurinic or apyrimidinic site lyase 0.002 0.0004 0.0002
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0085 0.0117 0.1389
Echinococcus multilocularis Protein kinase C, brain isozyme 0.0023 0.0009 0.0008
Brugia malayi AMP-binding enzyme family protein 0.0025 0.0013 0.0011
Echinococcus multilocularis guanine nucleotide binding protein G(s) subunit 0.0046 0.005 0.0053
Brugia malayi AMP-binding enzyme family protein 0.0025 0.0013 0.0011
Plasmodium falciparum RAC-beta serine/threonine protein kinase 0.0035 0.003 1
Trichomonas vaginalis STE family protein kinase 0.0498 0.0843 1
Mycobacterium ulcerans acyl-CoA synthetase 0.0025 0.0013 1
Schistosoma mansoni serine/threonine protein kinase 0.0023 0.0009 0.0087
Schistosoma mansoni transcription factor LCR-F1 0.0075 0.01 0.1167
Trichomonas vaginalis AGC family protein kinase 0.0069 0.0089 0.1055
Loa Loa (eye worm) hypothetical protein 0.0042 0.0042 0.004
Echinococcus multilocularis phosphatidylinositol 4,5 bisphosphate 3 kinase 0.0226 0.0365 0.0398
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0046 0.0538
Entamoeba histolytica hypothetical protein 0.0488 0.0825 0.9732
Leishmania major target of rapamycin (TOR) kinase 2, putative 0.0058 0.007 1
Echinococcus multilocularis nervana 2 0.0025 0.0012 0.0011
Trichomonas vaginalis phosphatidylinositol 4-kinase, putative 0.0019 0.0002 0.0018
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0122 0.0182 0.0181
Echinococcus multilocularis Basic leucine zipper (bZIP) transcription 0.0075 0.01 0.0107
Trypanosoma brucei phosphatidylinositol 4-kinase, putative 0.0058 0.007 1
Mycobacterium tuberculosis Fatty-acid-AMP ligase FadD30 (fatty-acid-AMP synthetase) (fatty-acid-AMP synthase) 0.0019 0.0002 0.139
Entamoeba histolytica p21-activated kinase 0.05 0.0847 1
Trypanosoma brucei phosphatidylinositol 3-kinase, putative 0.0022 0.0007 0.0719
Onchocerca volvulus 0.0306 0.0506 1
Echinococcus multilocularis serine:threonine protein kinase N2 0.0023 0.0009 0.0008
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0032 0.0372
Entamoeba histolytica protein kinase, putative 0.0498 0.0843 0.9949
Loa Loa (eye worm) AGC/PDK1 protein kinase 0.0069 0.0089 0.0087
Trichomonas vaginalis PIKK family atypical protein kinase 0.004 0.0039 0.0455
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0007 0.0076
Trichomonas vaginalis STE family protein kinase 0.0498 0.0843 1
Mycobacterium ulcerans acyl-CoA synthetase 0.0025 0.0013 1
Schistosoma mansoni serine/threonine protein kinase 0.0069 0.0089 0.1039
Entamoeba histolytica PH domain containing protein kinase, putative 0.0038 0.0035 0.039
Chlamydia trachomatis acylglycerophosphoethanolamine acyltransferase 0.0019 0.0002 0.5
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0056 0.0067 0.0769
Leishmania major 4-coumarate:coa ligase-like protein 0.0025 0.0013 0.1641
Echinococcus granulosus phosphatidylinositol 4 phosphate 3 kinase C2 0.008 0.0109 0.0118
Echinococcus granulosus sodium:potassium dependent atpase beta subunit 0.0025 0.0012 0.0011
Loa Loa (eye worm) AGC/PKC/ETA protein kinase 0.0023 0.0009 0.0007
Echinococcus multilocularis DNA (apurinic or apyrimidinic site) lyase 0.002 0.0004 0.0002
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0051 0.0596
Loa Loa (eye worm) AGC/RSK/MSK protein kinase 0.0023 0.0009 0.0007
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0058 0.007 0.0068
Echinococcus multilocularis nervana 2 0.0025 0.0012 0.0011
Entamoeba histolytica hypothetical protein 0.0075 0.01 0.1161
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0007 0.0076
Trichomonas vaginalis AGC family protein kinase 0.005 0.0057 0.0672
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0043 0.0044 0.0502
Echinococcus multilocularis serine:threonine protein kinase 38 0.0023 0.0009 0.0008
Leishmania major phosphatidylinositol 3-related kinase, putative 0.0022 0.0007 0.0719
Brugia malayi phosphoinositide 3'-hydroxykinase p110-alpha subunit, putative 0.0104 0.0152 0.015
Toxoplasma gondii AGC kinase 0.0048 0.0053 1
Echinococcus multilocularis p21 activated protein kinase 1 Dpak1 0.0498 0.0843 0.092
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0046 0.0538
Echinococcus multilocularis Glutaredoxin protein 5 0.0025 0.0012 0.0011
Schistosoma mansoni phosphatidylinositol 3-and 4-kinase 0.0022 0.0007 0.0058
Schistosoma mansoni serine/threonine protein kinase 0.0488 0.0825 0.9782
Schistosoma mansoni hypothetical protein 0.0488 0.0825 0.9782
Echinococcus granulosus ribosomal protein s6 kinase beta 1 0.0023 0.0009 0.0008
Brugia malayi Protein kinase domain 0.0498 0.0843 0.0841
Entamoeba histolytica acyl-coA synthetase, putative 0.0025 0.0013 0.0132
Echinococcus multilocularis serine:threonine protein kinase N2 0.0023 0.0009 0.0008
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative 0.0122 0.0182 1
Giardia lamblia GTOR 0.0058 0.007 0.0789
Schistosoma mansoni serine/threonine-protein kinase 0.0038 0.0035 0.0392
Brugia malayi hypothetical protein 0.0306 0.0506 0.0504
Trichomonas vaginalis AGC family protein kinase 0.0069 0.0089 0.1055
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.007 0.0827
Loa Loa (eye worm) hypothetical protein 0.0025 0.0013 0.0011

Activities

Activity type Activity value Assay description Source Reference
Inhibition (ADMET) = 27 % Inhibition of CYP1A2 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 27 % Inhibition of CYP2C9 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 27 % Inhibition of CYP2D6 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 27 % Inhibition of CYP3A4 at 3 uM ChEMBL. 22040023
Ki (binding) = 1 nM Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence-based spectrophotometry ChEMBL. 22040023
Ki (binding) = 100 nM Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assay ChEMBL. 22040023
Ki (binding) = 150 nM Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assay ChEMBL. 22040023
Ki (binding) = 2100 nM Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assay ChEMBL. 22040023

Phenotypes

Whole-cell/tissue/organism interactions

We have no records of whole-cell/tissue assays done with this compound What does this mean?

Many chemical entities in TDR Targets come from high-throughput screenings with whole cells or tissue samples, and not all assayed compounds have been tested against a single a single target protein, probably because they get ruled out during screening process. Even if these compounds may have not been of interest in the original screening, they may come as interesting leads for other screening assays. Furthermore, we may be able to propose drug-target associations using chemical similarities and network patterns.

Annotated phenotypes:

We have no manually annotated phenotypes for this drug. What does this mean? / Care to help?
In TDR Targets, information about phenotypes that are caused by drugs, or by genetic manipulation of cells (e.g. gene knockouts or knockdowns) is manually curated from the literature. These descriptions help to describe the potential of the target for drug development. If no information is available for this gene or if the information is incomplete, this may mean that i) the papers containing this information either appeared after the curation effort for this organism was carried out or they were inadvertently missed by curators; or that ii) the curation effort for this organism has not yet started.
 
In any case, if you have information about papers containing relevant validation data for this target, please log in using your TDR Targets username and password and send them to us using the corresponding form in this page (only visible to registered users) or contact us.

External resources for this compound

Bibliographic References

1 literature reference was collected for this gene.

If you have references for this compound, please enter them in a user comment (below) or Contact us.