Detailed information for compound 1589402

Basic information

Technical information
  • Name: Unnamed compound
  • MW: 484.553 | Formula: C26H28N8O2
  • H donors: 2 H acceptors: 6 LogP: 2.05 Rotable bonds: 7
    Rule of 5 violations (Lipinski): 1
  • SMILES: CC(=O)N1CC[C@H]([C@H]1c1ccccc1)Nc1cncc(n1)C(=O)c1cn(c2c1c(N)ncn2)C(C)C
  • InChi: 1S/C26H28N8O2/c1-15(2)34-13-18(22-25(27)29-14-30-26(22)34)24(36)20-11-28-12-21(32-20)31-19-9-10-33(16(3)35)23(19)17-7-5-4-6-8-17/h4-8,11-15,19,23H,9-10H2,1-3H3,(H,31,32)(H2,27,29,30)/t19-,23-/m1/s1
  • InChiKey: WAJYOJVNNBMVIM-AUSIDOKSSA-N  


Substructure search Similarity search

Network

Hover on a compound node to display the structore

Synonyms

No synonyms found for this compound

Targets

Known targets for this compound

Species Target name Source Bibliographic reference
Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 Starlite/ChEMBL References
Homo sapiens mechanistic target of rapamycin (serine/threonine kinase) Starlite/ChEMBL References
Homo sapiens MAP/microtubule affinity-regulating kinase 1 Starlite/ChEMBL References
Homo sapiens v-akt murine thymoma viral oncogene homolog 1 Starlite/ChEMBL References
Homo sapiens glycogen synthase kinase 3 beta Starlite/ChEMBL References
Homo sapiens 3-phosphoinositide dependent protein kinase 1 Starlite/ChEMBL References
Mus musculus phosphatidylinositol 3-kinase, catalytic, alpha polypeptide Starlite/ChEMBL References
Homo sapiens aurora kinase A Starlite/ChEMBL References

Predicted pathogen targets for this compound

By orthology
Species Potential target Known druggable target/s Ortholog Group
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei phosphatidylinositol 3-kinase tor, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative Get druggable targets OG5_127444 All targets in OG5_127444
Leishmania infantum target of rapamycin (TOR) kinase 1, putative Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) phosphatidylinositol 3 Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis CMGC family protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Candida albicans similar to internal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in n Get druggable targets OG5_127212 All targets in OG5_127212
Neospora caninum hypothetical protein Get druggable targets OG5_127024 All targets in OG5_127024
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus granulosus serine:threonine protein kinase MARK2 Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis phopsphatidylinositol 3-kinase, drosophila, putative Get druggable targets OG5_127444 All targets in OG5_127444
Entamoeba histolytica hypothetical protein Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus granulosus 3-phosphoinositide-dependent protein kinase 1 Get druggable targets OG5_128785 All targets in OG5_128785
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus aurora kinase A Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma japonicum ko:K04456 RAC serine/threonine-protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Babesia bovis protein kinase domain containing protein Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica protein kinase 2, putative Get druggable targets OG5_126635 All targets in OG5_126635
Loa Loa (eye worm) CMGC/GSK protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Toxoplasma gondii cell-cycle-associated protein kinase GSK, putative Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Loa Loa (eye worm) phosphatidylinositol 3 Get druggable targets OG5_127444 All targets in OG5_127444
Trypanosoma brucei aurora B kinase Get druggable targets OG5_127024 All targets in OG5_127024
Plasmodium knowlesi glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Neospora caninum hypothetical protein Get druggable targets OG5_126888 All targets in OG5_126888
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania major protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Leishmania donovani phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Candida albicans similar to N terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) putative protein/phosphatidylinositol kinases in Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) AGC/AKT protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica protein kinase domain containing protein Get druggable targets OG5_126888 All targets in OG5_126888
Schistosoma japonicum Serine/threonine-protein kinase 12, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma mansoni ataxia telangiectasia mutated (atm)-related Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania braziliensis protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Giardia lamblia Kinase, CMGC GSK Get druggable targets OG5_126888 All targets in OG5_126888
Candida albicans likely protein kinase similar to S. cerevisiae YPK2 (YMR104C) Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi serine/threonine protein kinase 6 Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Candida albicans similar to internal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in n Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania infantum target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus serine:threonine protein kinase MARK2 Get druggable targets OG5_128024 All targets in OG5_128024
Neospora caninum Phosphatidylinositol 3-kinase tor2, related Get druggable targets OG5_127212 All targets in OG5_127212
Theileria parva glycogen synthase kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Loa Loa (eye worm) AGC/PDK1 protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit gamma, putative Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus granulosus sodium:potassium dependent atpase beta subunit Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei protein kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Toxoplasma gondii AGC kinase Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania major target of rapamycin (TOR) kinase 1, putative Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Trypanosoma brucei phosphatidylinositol 4-kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum ko:K08850 aurora kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma brucei gambiense protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma mansoni glycogen synthase kinase 3-related (gsk3) (cmgc group III) Get druggable targets OG5_126888 All targets in OG5_126888
Trypanosoma congolense Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Giardia lamblia GTOR Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium yoelii Protein kinase domain, putative Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma mansoni serine/threonine-protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis rac serine:threonine kinase Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans likely protein kinase similar to S. cerevisiae KIN1 (YDR122W) and KIN2 (YLR096W) Get druggable targets OG5_128024 All targets in OG5_128024
Trypanosoma congolense aurora B kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Echinococcus granulosus glycogen synthase kinase 3 beta Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica phosphatidylinositol 3-kinase 1, putative Get druggable targets OG5_127444 All targets in OG5_127444
Plasmodium berghei glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Trypanosoma brucei gambiense phosphatidylinositol 3-kinase tor, putative Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica serine/threonine- protein kinase 6, putative Get druggable targets OG5_127024 All targets in OG5_127024
Leishmania donovani Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus protein kinase shaggy Get druggable targets OG5_126888 All targets in OG5_126888
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Candida albicans frameshifted from upsteam TOR2 CDS (CaP19.9461) Get druggable targets OG5_127212 All targets in OG5_127212
Neospora caninum Ribosomal protein S6 kinase alpha-6 (EC 2.7.11.1), related Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis serine:threonine protein kinase MARK2 Get druggable targets OG5_128024 All targets in OG5_128024
Echinococcus multilocularis 3 phosphoinositide dependent protein kinase 1 Get druggable targets OG5_128785 All targets in OG5_128785
Leishmania mexicana protein kinase, putative,glycogen synthase kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Leishmania infantum protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans second truncated form of RIM11 Serine/threonine protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Schistosoma japonicum ko:K06276 3-phosphoinositide dependent protein kinase-1, putative Get druggable targets OG5_128785 All targets in OG5_128785
Echinococcus multilocularis serine:threonine protein kinase MARK2 Get druggable targets OG5_128024 All targets in OG5_128024
Leishmania donovani glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Loa Loa (eye worm) AGC/PDK1 protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Loa Loa (eye worm) AGC/RSK/P70 protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus serine:threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Brugia malayi serine/threonine kinase 12 Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica protein kinase domain containing protein Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica protein kinase , putative Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma cruzi rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K Get druggable targets OG5_127444 All targets in OG5_127444
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans similar to S. cerevisiae protein kinases PKH1 (YDR490C) and PKH2 (YOL100W) involved in MAPKKK cascade Get druggable targets OG5_128785 All targets in OG5_128785
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Giardia lamblia Aurora kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi intracellular kinase Get druggable targets OG5_126888 All targets in OG5_126888
Cryptosporidium parvum protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Brugia malayi p70 ribosomal S6 kinase beta Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus multilocularis FKBP12 rapamycin complex associated protein Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica FKBP-rapamycin associated protein (FRAP), putative Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium vivax glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Leishmania major target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis protein kinase shaggy Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Giardia lamblia Kinase, CMGC GSK Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis CAMK family protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Giardia lamblia Kinase, AGC PKA Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Cryptosporidium parvum hypothetical protein Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus serine:threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Echinococcus multilocularis serine:threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Leishmania infantum glycogen synthase kinase 3 Get druggable targets OG5_126888 All targets in OG5_126888
Candida albicans likely protein kinase similar to S. cerevisiae IPL1 (YPL209C) Aurora protein kinase involved in regulating kinetochore-microtubu Get druggable targets OG5_127024 All targets in OG5_127024
Leishmania infantum phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium berghei rac-beta serine/threonine protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma mansoni protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans likely protein kinase similar to S. cerevisiae IPL1 (YPL209C) Aurora protein kinase involved in regulating kinetochore-microtubu Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma congolense rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis serine:threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Leishmania braziliensis target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans similar to S. cerevisiae protein kinases PKH1 (YDR490C) and PKH2 (YOL100W) involved in MAPKKK cascade Get druggable targets OG5_128785 All targets in OG5_128785
Echinococcus granulosus Glutaredoxin protein 5 Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium yoelii putative protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Trypanosoma cruzi aurora B kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_128785 All targets in OG5_128785
Loa Loa (eye worm) AUR protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) AUR protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus multilocularis aurora kinase A Get druggable targets OG5_127024 All targets in OG5_127024
Leishmania mexicana phosphatidylinositol 3 kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium yoelii kinase Akt/PKB-related Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus calcium:calmodulin dependent protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus serine threonine protein kinase nrc Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma cruzi rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium falciparum glycogen synthase kinase 3 Get druggable targets OG5_126888 All targets in OG5_126888
Cryptosporidium hominis protein kinase (EC 2.7.1.-) p46XlEg22 Get druggable targets OG5_127024 All targets in OG5_127024
Plasmodium vivax serine/threonine protein kinase 6, putative Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus granulosus phosphatidylinositol 45 bisphosphate 3 kinase Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus multilocularis nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium knowlesi serine/threonine protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica PH domain containing protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum Sodium/potassium-transporting ATPase subunit beta-1, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis serine threonine protein kinase nrc serine threonine protein kinase gad Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium falciparum serine/threonine protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi Protein kinase B Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum ko:K07390 monothiol glutaredoxin, putative Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans frameshifted from upstream TOR2 CDS (CaP19.1905) Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus multilocularis phosphatidylinositol 4,5 bisphosphate 3 kinase Get druggable targets OG5_127444 All targets in OG5_127444
Plasmodium vivax rac-beta serine/threonine protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Onchocerca volvulus Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma brucei gambiense protein kinase, putative,glycogen synthase kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Candida albicans Serine/threonine protein kinase required for induction of IME2 by Ime1p Get druggable targets OG5_126888 All targets in OG5_126888
Candida albicans similar to N terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) putative protein/phosphatidylinositol kinases in Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis CMGC family protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Toxoplasma gondii aurora kinase Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma japonicum ko:K00922 phosphatidylinositol-4,5-bisphosphate 3-kinase [EC2.7.1.153], putative Get druggable targets OG5_127444 All targets in OG5_127444
Toxoplasma gondii target of rapamycin (TOR), putative Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania donovani Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Schistosoma japonicum ko:K08822 glycogen synthase kinase 3 alpha, putative Get druggable targets OG5_126888 All targets in OG5_126888
Trypanosoma brucei gambiense rac serine-threonine kinase, putative,protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma congolense Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica PH domain containing protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania major glycogen synthase kinase, putative;with=GeneDB:LinJ18_V3.0270 Get druggable targets OG5_126888 All targets in OG5_126888
Loa Loa (eye worm) CMGC/GSK protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica protein kinase domain containing protein Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans second truncated form of RIM11 Serine/threonine protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Loa Loa (eye worm) CAMK/CAMKL/MARK protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Echinococcus granulosus serine:threonine protein kinase 12 B Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Leishmania donovani Aurora I-related kinase Get druggable targets OG5_127024 All targets in OG5_127024
Leishmania mexicana phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis phosphatidylinositol kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Entamoeba histolytica serine/threonine- protein kinase 6 , putative Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica serine/threonine protein kinase 6, putative Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus multilocularis serine:threonine protein kinase 12 B Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus granulosus nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi phosphoinositide-dependent protein kinase I Get druggable targets OG5_128785 All targets in OG5_128785
Loa Loa (eye worm) AUR protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma congolense protein kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Plasmodium knowlesi RAC-beta serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma mansoni serine/threonine-protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania mexicana protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma cruzi glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus multilocularis glycogen synthase kinase 3 beta Get druggable targets OG5_126888 All targets in OG5_126888
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_128785 All targets in OG5_128785
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus FKBP12 rapamycin complex associated protein Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis Glutaredoxin protein 5 Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium falciparum RAC-beta serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania braziliensis protein kinase, putative,glycogen synthase kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus multilocularis sodium:potassium dependent atpase beta subunit Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium yoelii Protein kinase domain, putative Get druggable targets OG5_126888 All targets in OG5_126888
Schistosoma japonicum ko:K08798 MAP/microtubule affinity-regulating kinase, putative Get druggable targets OG5_128024 All targets in OG5_128024
Schistosoma japonicum RAC serine/threonine-protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Giardia lamblia Phosphoinositide-3-kinase, catalytic, alpha polypeptide Get druggable targets OG5_127444 All targets in OG5_127444
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_127444 All targets in OG5_127444
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica phosphatidylinositol3-kinaseTor2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi serine/threonine-protein kinase 6 Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania mexicana phosphatidylinositol 3-kinase (tor2)-like protein Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Cryptosporidium hominis hypothetical protein Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Schistosoma japonicum ko:K08792 serum/glucocorticoid regulated kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum ko:K07203 FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium berghei serine/threonine protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans hypothetical protein Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma brucei gambiense phosphatidylinositol 3 kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
By sequence similarity to non orthologous known druggable targets
Species Potential target Known druggable target Length Alignment span Identity
Entamoeba histolytica phosphatidylinositol 3-kinase, putative phosphatidylinositol 3-kinase, catalytic, alpha polypeptide 1068 aa 927 aa 29.0 %
Obtained from network model

Ranking Plot

Putative Targets List

Species Potential target Raw Global Species
Entamoeba histolytica hypothetical protein 0.0098 0.3918 0.7652
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K 0.0043 0.1333 0.1167
Trichomonas vaginalis CMGC family protein kinase 0.006 0.2121 0.419
Trichomonas vaginalis AGC family protein kinase 0.007 0.26 0.5135
Plasmodium falciparum RAC-beta serine/threonine protein kinase 0.0027 0.0571 0.1586
Loa Loa (eye worm) phosphatidylinositol 3 0.0202 0.8855 1
Trypanosoma brucei FAT domain/Rapamycin binding domain/Phosphatidylinositol 3- and 4-kinase, putative 0.0026 0.0526 0.1402
Loa Loa (eye worm) phosphatidylinositol 3 0.0022 0.0321 0.0362
Trypanosoma brucei aurora B kinase 0.007 0.26 1
Entamoeba histolytica serine/threonine- protein kinase 6 , putative 0.007 0.26 0.4947
Plasmodium falciparum glycogen synthase kinase 3 0.006 0.2121 0.8016
Entamoeba histolytica PH domain containing protein kinase, putative 0.0029 0.0688 0.1026
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0321 0.0633
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.1504 0.297
Echinococcus granulosus serine threonine protein kinase nrc 0.0027 0.0571 0.039
Trypanosoma cruzi phosphatidylinositol 3-kinase, putative 0.0036 0.1001 0.1668
Toxoplasma gondii cell-cycle-associated protein kinase GSK, putative 0.006 0.2121 0.816
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit gamma, putative 0.0122 0.5063 1
Echinococcus multilocularis phosphatidylinositol 3 and 4 kinase 0.0022 0.0321 0.0135
Entamoeba histolytica serine/threonine- protein kinase 6, putative 0.007 0.26 0.4947
Schistosoma mansoni serine/threonine protein kinase 0.0039 0.1137 0.0967
Schistosoma mansoni serine/threonine protein kinase 0.0039 0.1137 0.0967
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0321 0.0633
Entamoeba histolytica FKBP-rapamycin associated protein (FRAP), putative 0.0058 0.203 0.3778
Entamoeba histolytica protein kinase, putative 0.0042 0.1287 0.2253
Echinococcus multilocularis calcium activated potassium channel 0.0039 0.1137 0.0967
Trichomonas vaginalis PIKK family atypical protein kinase 0.0039 0.1128 0.2227
Trichomonas vaginalis AGC family protein kinase 0.006 0.2159 0.4264
Brugia malayi serine/threonine kinase 12 0.007 0.26 0.4947
Plasmodium vivax rac-beta serine/threonine protein kinase, putative 0.0027 0.0571 0.1586
Trypanosoma cruzi rac serine-threonine kinase, putative 0.0029 0.0688 0.1026
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.203 0.4009
Giardia lamblia GTOR 0.0058 0.203 0.7192
Trichomonas vaginalis PIKK family atypical protein kinase 0.004 0.1183 0.2337
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.1371 0.2708
Loa Loa (eye worm) AGC/AKT protein kinase 0.0042 0.1287 0.1453
Plasmodium vivax serine/threonine protein kinase 6, putative 0.007 0.26 1
Echinococcus multilocularis serine:threonine protein kinase 12 B 0.007 0.26 0.2458
Entamoeba histolytica protein kinase domain containing protein 0.007 0.26 0.4947
Entamoeba histolytica phosphatidylinositol 3-kinase 1, putative 0.0115 0.4731 0.9319
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.203 0.4009
Echinococcus granulosus protein kinase shaggy 0.006 0.2121 0.197
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative 0.0022 0.0321 0.0272
Loa Loa (eye worm) AGC/PDK1 protein kinase 0.006 0.2159 0.2438
Leishmania major target of rapamycin kinase (TOR) kinase 3 0.0047 0.1506 0.5464
Loa Loa (eye worm) CAMK/CAMKL/MELK protein kinase 0.0039 0.1137 0.1284
Loa Loa (eye worm) phosphatidylinositol 3 0.0058 0.203 0.2292
Brugia malayi Protein kinase domain containing protein 0.0051 0.1707 0.3116
Trypanosoma brucei rac serine-threonine kinase, putative 0.0042 0.1287 0.4554
Trypanosoma brucei protein kinase, putative 0.006 0.2121 0.8016
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0098 0.3918 0.7652
Brugia malayi Kinase associated domain 1 family protein 0.0037 0.1032 0.1731
Trypanosoma brucei phosphatidylinositol 3-related kinase, putative 0.0022 0.0321 0.0549
Schistosoma mansoni hypothetical protein 0.0037 0.1032 0.086
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.098 0.1935
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0321 0.0633
Trichomonas vaginalis AGC family protein kinase 0.0042 0.1287 0.2541
Brugia malayi Protein kinase domain containing protein 0.006 0.2159 0.4043
Trichomonas vaginalis AGC family protein kinase 0.007 0.26 0.5135
Trypanosoma cruzi target of rapamycin kinase 3 0.0047 0.1506 0.2703
Entamoeba histolytica PH domain containing protein kinase, putative 0.0029 0.0688 0.1026
Schistosoma mansoni ataxia telangiectasia mutated (atm)-related 0.0058 0.203 0.1877
Leishmania major phosphatidylinositol 3-kinase, putative 0.0022 0.0321 0.0549
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.1504 0.297
Toxoplasma gondii phosphatidylinositol 3- and 4-kinase 0.0019 0.0188 0.0724
Brugia malayi intracellular kinase 0.006 0.2121 0.3966
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0122 0.5063 1
Leishmania major glycogen synthase kinase, putative;with=GeneDB:LinJ18_V3.0270 0.006 0.2121 0.8016
Echinococcus multilocularis aurora kinase A 0.007 0.26 0.2458
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K 0.0226 1 1
Plasmodium vivax glycogen synthase kinase 3, putative 0.006 0.2121 0.8016
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.008 0.3088 0.5949
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.1371 0.2708
Brugia malayi serine/threonine protein kinase 6 0.007 0.26 0.4947
Trypanosoma cruzi rac serine-threonine kinase, putative 0.0027 0.0571 0.0785
Trichomonas vaginalis PIKK family atypical protein kinase 0.005 0.1654 0.3267
Leishmania major phosphatidylinositol 3-related kinase, putative 0.0022 0.0321 0.0549
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0845 0.1668
Giardia lamblia Kinase, CMGC GSK 0.006 0.2121 0.7642
Toxoplasma gondii aurora kinase 0.007 0.26 1
Trypanosoma brucei phosphatidylinositol 4-kinase, putative 0.0058 0.203 0.7637
Entamoeba histolytica protein kinase domain containing protein 0.006 0.2121 0.3966
Giardia lamblia Kinase, CMGC GSK 0.006 0.2121 0.7642
Entamoeba histolytica protein kinase, putative 0.006 0.2121 0.3966
Echinococcus multilocularis protein kinase shaggy 0.006 0.2121 0.197
Loa Loa (eye worm) AUR protein kinase 0.007 0.26 0.2936
Brugia malayi phosphoinositide 3'-hydroxykinase p110-alpha subunit, putative 0.0104 0.4229 0.8289
Entamoeba histolytica protein kinase, putative 0.007 0.26 0.4947
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.1504 0.297
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0847 0.1672
Echinococcus granulosus FKBP12 rapamycin complex associated protein 0.0058 0.203 0.1877
Schistosoma mansoni serine/threonine-protein kinase 0.0029 0.0688 0.051
Brugia malayi Protein kinase domain containing protein 0.0039 0.1137 0.1947
Echinococcus multilocularis glycogen synthase kinase 3 beta 0.006 0.2121 0.197
Schistosoma mansoni serine/threonine kinase 0.0039 0.1137 0.0967
Trichomonas vaginalis CAMK family protein kinase 0.0039 0.1137 0.2246
Schistosoma mansoni glycogen synthase kinase 3-related (gsk3) (cmgc group III) 0.006 0.2121 0.197
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.1371 0.2708
Trypanosoma brucei Phosphatidylinositol 3-kinase tor1 0.0058 0.203 0.7637
Echinococcus multilocularis serine:threonine protein kinase 0.0051 0.1707 0.1548
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.1504 0.297
Toxoplasma gondii target of rapamycin (TOR), putative 0.0044 0.1371 0.5273
Entamoeba histolytica phosphatidylinositol3-kinaseTor2, putative 0.0058 0.203 0.3778
Echinococcus granulosus aurora kinase A 0.007 0.26 0.2458
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0019 0.0188 0.0372
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0321 0.0633
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0043 0.1333 0.2348
Echinococcus granulosus serine:threonine protein kinase MARK2 0.0088 0.3447 0.3321
Giardia lamblia Phosphoinositide-3-kinase, class 3 0.0031 0.0769 0.0976
Giardia lamblia Phosphoinositide-3-kinase, catalytic, alpha polypeptide 0.0061 0.2163 0.7846
Trichomonas vaginalis AGC family protein kinase 0.007 0.26 0.5135
Trichomonas vaginalis CAMK family protein kinase 0.0051 0.1707 0.3372
Loa Loa (eye worm) phosphatidylinositol 3 0.0036 0.1001 0.113
Echinococcus multilocularis serine:threonine protein kinase MARK2 0.0088 0.3447 0.3321
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0847 0.1672
Loa Loa (eye worm) hypothetical protein 0.0051 0.1707 0.1928
Loa Loa (eye worm) AGC/RSK/P70 protein kinase 0.004 0.1169 0.132
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor1 0.0058 0.203 0.3778
Entamoeba histolytica protein kinase, putative 0.0042 0.1287 0.2253
Echinococcus granulosus sodium:potassium dependent atpase beta subunit 0.0025 0.0465 0.0282
Trichomonas vaginalis phosphatidylinositol 4-kinase, putative 0.0019 0.0188 0.0372
Trichomonas vaginalis AGC family protein kinase 0.006 0.2159 0.4264
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0847 0.1672
Echinococcus multilocularis sodium:potassium dependent atpase beta subunit 0.0025 0.0465 0.0282
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0085 0.3308 0.6533
Trichomonas vaginalis AGC family protein kinase 0.0042 0.1287 0.2541
Schistosoma mansoni hypothetical protein 0.0037 0.1032 0.086
Echinococcus granulosus glycogen synthase kinase 3 beta 0.006 0.2121 0.197
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0043 0.1333 0.2633
Trichomonas vaginalis CMGC family protein kinase 0.006 0.2121 0.419
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0043 0.1333 0.2348
Entamoeba histolytica protein kinase , putative 0.007 0.26 0.4947
Entamoeba histolytica serine/threonine protein kinase 6, putative 0.007 0.26 0.4947
Onchocerca volvulus 0.006 0.2121 0.5
Echinococcus multilocularis 3 phosphoinositide dependent protein kinase 1 0.006 0.2159 0.2009
Loa Loa (eye worm) hypothetical protein 0.008 0.3088 0.3488
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0995 0.1965
Echinococcus multilocularis Glutaredoxin protein 5 0.0025 0.0465 0.0282
Echinococcus granulosus serine:threonine protein kinase 0.0051 0.1707 0.1548
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0019 0.0188 0.0372
Echinococcus granulosus serine:threonine protein kinase MARK2 0.0088 0.3447 0.3321
Toxoplasma gondii AGC kinase 0.004 0.1169 0.4497
Trichomonas vaginalis AGC family protein kinase 0.0017 0.0113 0.0224
Schistosoma mansoni serine/threonine protein kinase 0.0039 0.1137 0.0967
Echinococcus multilocularis hypothetical protein 0.0037 0.1032 0.086
Echinococcus granulosus 3-phosphoinositide-dependent protein kinase 1 0.006 0.2159 0.2009
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative 0.0043 0.1333 0.2633
Brugia malayi phosphoinositide-dependent protein kinase I 0.006 0.2159 0.4043
Trichomonas vaginalis AGC family protein kinase 0.0042 0.1287 0.2541
Echinococcus multilocularis FKBP12 rapamycin complex associated protein 0.0058 0.203 0.1877
Echinococcus multilocularis serine:threonine protein kinase MARK2 0.0088 0.3447 0.3321
Loa Loa (eye worm) AUR protein kinase 0.007 0.26 0.2936
Echinococcus granulosus Glutaredoxin protein 5 0.0025 0.0465 0.0282
Brugia malayi p70 ribosomal S6 kinase beta 0.004 0.1169 0.2012
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0845 0.1668
Echinococcus granulosus nervana 2 0.0025 0.0465 0.0282
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0995 0.1965
Schistosoma mansoni serine/threonine-protein kinase 0.0029 0.0688 0.051
Loa Loa (eye worm) CMGC/GSK protein kinase 0.006 0.2121 0.2396
Trypanosoma brucei target of rapamycin kinase 3, putative 0.0047 0.1506 0.5464
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0845 0.1668
Toxoplasma gondii phosphatidylinositol 3- and 4-kinase 0.0019 0.0188 0.0724
Loa Loa (eye worm) hypothetical protein 0.0042 0.1267 0.1431
Schistosoma mansoni serine/threonine protein kinase 0.007 0.26 0.2458
Echinococcus multilocularis nervana 2 0.0025 0.0465 0.0282
Echinococcus granulosus phosphatidylinositol 3 and 4 kinase 0.0022 0.0321 0.0135
Loa Loa (eye worm) AGC/PDK1 protein kinase 0.006 0.2159 0.2438
Echinococcus granulosus calcium activated potassium channel 0.0039 0.1137 0.0967
Trichomonas vaginalis AGC family protein kinase 0.0042 0.1287 0.2541
Giardia lamblia Aurora kinase 0.007 0.26 1
Echinococcus granulosus serine/threonine protein kinase 0.0029 0.0688 0.051
Trichomonas vaginalis AGC family protein kinase 0.007 0.26 0.5135
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0058 0.203 0.3778
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0995 0.1965
Schistosoma mansoni serine/threonine protein kinase 0.0088 0.3447 0.3321
Trichomonas vaginalis phopsphatidylinositol 3-kinase, drosophila, putative 0.0122 0.5063 1
Trypanosoma cruzi glycogen synthase kinase 3, putative 0.006 0.2121 0.3966
Leishmania major protein kinase, putative 0.007 0.26 1
Trichomonas vaginalis AGC family protein kinase 0.0042 0.1287 0.2541
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.203 0.4009
Echinococcus granulosus serine:threonine protein kinase 12 B 0.007 0.26 0.2458
Echinococcus multilocularis serine:threonine protein kinase 0.0051 0.1707 0.1548
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0043 0.1333 0.2633
Schistosoma mansoni phosphatidylinositol 3-and 4-kinase 0.0022 0.0321 0.0135
Loa Loa (eye worm) phosphatidylinositol 4-kinase type 3 alpha isoform 1 0.0019 0.0188 0.0212
Trichomonas vaginalis AGC family protein kinase 0.0042 0.1287 0.2541
Trichomonas vaginalis AGC family protein kinase 0.006 0.2159 0.4264
Echinococcus multilocularis serine threonine protein kinase nrc serine threonine protein kinase gad 0.0027 0.0571 0.039
Brugia malayi Protein kinase domain containing protein 0.0042 0.1287 0.2253
Loa Loa (eye worm) CAMK/CAMKL/MARK protein kinase 0.0051 0.1707 0.1928
Brugia malayi serine/threonine-protein kinase 6 0.007 0.26 0.4947
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.1371 0.2708
Echinococcus granulosus phosphatidylinositol 4 phosphate 3 kinase C2 0.008 0.3088 0.2956
Leishmania major target of rapamycin (TOR) kinase 2, putative 0.0058 0.203 0.7637
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0022 0.0321 0.0272
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative 0.0122 0.5063 1
Schistosoma mansoni protein kinase 0.007 0.26 0.2458
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0321 0.0633
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative 0.0122 0.5063 1
Echinococcus multilocularis nervana 2 0.0025 0.0465 0.0282
Entamoeba histolytica protein kinase, putative 0.004 0.1169 0.2012
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative 0.0022 0.0321 0.0272
Echinococcus multilocularis phosphatidylinositol 4,5 bisphosphate 3 kinase 0.0226 1 1
Trypanosoma cruzi aurora B kinase, putative 0.007 0.26 0.4947
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.1504 0.297
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0122 0.5063 1
Echinococcus multilocularis rac serine:threonine kinase 0.0029 0.0688 0.051
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0847 0.1672
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0043 0.1333 0.2348
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.1371 0.2708
Entamoeba histolytica protein kinase, putative 0.006 0.2159 0.4043
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.1371 0.2708
Entamoeba histolytica protein kinase, putative 0.007 0.26 0.4947
Trypanosoma brucei phosphatidylinositol 3-kinase, putative 0.0043 0.1333 0.4747
Plasmodium falciparum serine/threonine protein kinase, putative 0.007 0.26 1
Trypanosoma brucei phosphatidylinositol 3-kinase, putative 0.0022 0.0321 0.0549
Schistosoma mansoni serine/threonine protein kinase 0.006 0.2159 0.2009
Trichomonas vaginalis AGC family protein kinase 0.0042 0.1287 0.2541
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0122 0.5063 1
Loa Loa (eye worm) AUR protein kinase 0.007 0.26 0.2936
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.098 0.1935
Trichomonas vaginalis PIKK family atypical protein kinase 0.0018 0.0148 0.0292
Trypanosoma brucei phosphatidylinositol 3-kinase tor, putative 0.0029 0.0674 0.2016
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0056 0.1943 0.3601
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative 0.0085 0.3308 0.6533
Echinococcus granulosus serine:threonine protein kinase 0.0051 0.1707 0.1548
Echinococcus granulosus calcium:calmodulin dependent protein kinase 0.0027 0.0571 0.039
Entamoeba histolytica protein kinase domain containing protein 0.006 0.2121 0.3966
Trypanosoma cruzi phosphatidylinositol 3-kinase vps34-like 0.0043 0.1333 0.2348
Loa Loa (eye worm) hypothetical protein 0.0037 0.1032 0.1165
Trypanosoma cruzi Protein kinase B 0.0029 0.0688 0.1026
Leishmania major target of rapamycin (TOR) kinase 1, putative 0.0058 0.203 0.7637
Echinococcus multilocularis phosphatidylinositol 4 phosphate 3 kinase C2 0.008 0.3088 0.2956
Entamoeba histolytica protein kinase 2, putative 0.0027 0.0571 0.0785
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.1371 0.2708
Loa Loa (eye worm) CMGC/GSK protein kinase 0.006 0.2121 0.2396
Echinococcus granulosus nervana 2 0.0025 0.0465 0.0282
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor2 0.0058 0.203 0.3778
Schistosoma mansoni serine/threonine protein kinase 0.0088 0.3447 0.3321

Activities

Activity type Activity value Assay description Source Reference
EC50 (functional) = 1700 nM Antiproliferative activity against human H460 cells after 72 hrs by resazurin reduction assay ChEMBL. 22040023
EC50 (functional) = 5200 nM Antiproliferative activity against human A549 cells after 72 hrs by resazurin reduction assay ChEMBL. 22040023
IC50 (binding) = 200 nM Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human SKOV3 cells after 2 hrs by ELISA ChEMBL. 22040023
IC50 (binding) = 300 nM Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human A549 cells after 2 hrs by ELISA ChEMBL. 22040023
IC50 (binding) = 320 nM Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA ChEMBL. 22040023
IC50 (binding) = 820 nM Inhibition of Aurora A ChEMBL. 22040023
IC50 (binding) = 860 nM Inhibition of GSK3-beta ChEMBL. 22040023
IC50 (binding) = 910 nM Inhibition of TrkA ChEMBL. 22040023
IC50 (binding) = 1300 nM Inhibition of MARK1 ChEMBL. 22040023
Inhibition (binding) = -6 % Inhibition of MST4 at 1 uM ChEMBL. 22040023
Inhibition (binding) = -5 % Inhibition of ROCK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = -5 % Inhibition of TAOK2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = -3 % Inhibition of NEK2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = -2 % Inhibition of JAK3 at 1 uM ChEMBL. 22040023
Inhibition (binding) = -2 % Inhibition of PIM2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = -2 % Inhibition of EGFR at 1 uM ChEMBL. 22040023
Inhibition (binding) = -2 % Inhibition of MYLK2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 0 % Inhibition of STK3 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 2 % Inhibition of CSNK2A2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 3 % Inhibition of EPHA2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 3 % Inhibition of MAPK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 4 % Inhibition of MET at 1 uM ChEMBL. 22040023
Inhibition (binding) = 4 % Inhibition of INSR at 1 uM ChEMBL. 22040023
Inhibition (binding) = 5 % Inhibition of TEK at 1 uM ChEMBL. 22040023
Inhibition (binding) = 6 % Inhibition of FGFR1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 6 % Inhibition of MAPKAPK2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 7 % Inhibition of CHEK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 7 % Inhibition of CSNK1A1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 11 % Inhibition of LCK at 1 uM ChEMBL. 22040023
Inhibition (binding) = 12 % Inhibition of CDK2/cyclinA at 1 uM ChEMBL. 22040023
Inhibition (binding) = 14 % Inhibition of SRC at 1 uM ChEMBL. 22040023
Inhibition (binding) = 15 % Inhibition of AKT1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 23 % Inhibition of MAP4K4 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 25 % Inhibition of PAK4 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 30 % Inhibition of PRKACA at 1 uM ChEMBL. 22040023
Inhibition (binding) = 30 % Inhibition of SGK at 1 uM ChEMBL. 22040023
Inhibition (binding) = 32 % Inhibition of CAMK2A at 1 uM ChEMBL. 22040023
Inhibition (binding) = 34 % Inhibition of KDR at 1 uM ChEMBL. 22040023
Inhibition (binding) = 42 % Inhibition of GSK3B at 1 uM ChEMBL. 22040023
Inhibition (binding) = 47 % Inhibition of MARK1 at 1 uM ChEMBL. 22040023
Inhibition (ADMET) = 54 % Inhibition of CYP1A2 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 54 % Inhibition of CYP2C9 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 54 % Inhibition of CYP2D6 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 54 % Inhibition of CYP3A4 at 3 uM ChEMBL. 22040023
Inhibition (binding) = 54 % Inhibition of STK6 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 59 % Inhibition of NTRK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 94 % Inhibition of CHEK2 at 1 uM ChEMBL. 22040023
Ki (binding) = 1.4 nM Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence-based spectrophotometry ChEMBL. 22040023
Ki (binding) = 1100 nM Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assay ChEMBL. 22040023
Ki (binding) = 1900 nM Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assay ChEMBL. 22040023
Ki (binding) = 3900 nM Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assay ChEMBL. 22040023

Phenotypes

Whole-cell/tissue/organism interactions

Species name Source Reference Is orphan
Homo sapiens ChEMBL23 22040023

Many chemical entities in TDR Targets come from high-throughput screenings with whole cells or tissue samples, and not all assayed compounds have been tested against a single a single target protein, probably because they get ruled out during screening process. Even if these compounds may have not been of interest in the original screening, they may come as interesting leads for other screening assays. Furthermore, we may be able to propose drug-target associations using chemical similarities and network patterns.

Annotated phenotypes:

We have no manually annotated phenotypes for this drug. What does this mean? / Care to help?
In TDR Targets, information about phenotypes that are caused by drugs, or by genetic manipulation of cells (e.g. gene knockouts or knockdowns) is manually curated from the literature. These descriptions help to describe the potential of the target for drug development. If no information is available for this gene or if the information is incomplete, this may mean that i) the papers containing this information either appeared after the curation effort for this organism was carried out or they were inadvertently missed by curators; or that ii) the curation effort for this organism has not yet started.
 
In any case, if you have information about papers containing relevant validation data for this target, please log in using your TDR Targets username and password and send them to us using the corresponding form in this page (only visible to registered users) or contact us.

External resources for this compound

Bibliographic References

1 literature reference was collected for this gene.

If you have references for this compound, please enter them in a user comment (below) or Contact us.