Detailed information for compound 1589401

Basic information

Technical information
  • Name: Unnamed compound
  • MW: 502.543 | Formula: C26H27FN8O2
  • H donors: 2 H acceptors: 6 LogP: 2.15 Rotable bonds: 7
    Rule of 5 violations (Lipinski): 2
  • SMILES: Fc1ccc(cc1)[C@@H]1[C@@H](CCN1C(=O)C)Nc1cncc(n1)C(=O)c1cn(c2c1c(N)ncn2)C(C)C
  • InChi: 1S/C26H27FN8O2/c1-14(2)35-12-18(22-25(28)30-13-31-26(22)35)24(37)20-10-29-11-21(33-20)32-19-8-9-34(15(3)36)23(19)16-4-6-17(27)7-5-16/h4-7,10-14,19,23H,8-9H2,1-3H3,(H,32,33)(H2,28,30,31)/t19-,23-/m1/s1
  • InChiKey: PLZWVXKEQYGKTJ-AUSIDOKSSA-N  


Substructure search Similarity search

Network

Hover on a compound node to display the structore

Synonyms

No synonyms found for this compound

Targets

Known targets for this compound

Species Target name Source Bibliographic reference
Homo sapiens aurora kinase A Starlite/ChEMBL References
Homo sapiens mechanistic target of rapamycin (serine/threonine kinase) Starlite/ChEMBL References
Homo sapiens 3-phosphoinositide dependent protein kinase 1 Starlite/ChEMBL References
Homo sapiens neurotrophic tyrosine kinase, receptor, type 1 Starlite/ChEMBL References
Homo sapiens v-akt murine thymoma viral oncogene homolog 1 Starlite/ChEMBL References
Homo sapiens glycogen synthase kinase 3 beta Starlite/ChEMBL References
Homo sapiens MAP/microtubule affinity-regulating kinase 1 Starlite/ChEMBL References
Mus musculus phosphatidylinositol 3-kinase, catalytic, alpha polypeptide Starlite/ChEMBL References

Predicted pathogen targets for this compound

By orthology
Species Potential target Known druggable target/s Ortholog Group
Entamoeba histolytica phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Toxoplasma gondii target of rapamycin (TOR), putative Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania infantum protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K Get druggable targets OG5_127444 All targets in OG5_127444
Entamoeba histolytica phosphatidylinositol 3-kinase 1, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis sodium:potassium dependent atpase beta subunit Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi intracellular kinase Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis CAMK family protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative Get druggable targets OG5_127444 All targets in OG5_127444
Cryptosporidium parvum hypothetical protein Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus granulosus serine threonine protein kinase nrc Get druggable targets OG5_126635 All targets in OG5_126635
Giardia lamblia GTOR Get druggable targets OG5_127212 All targets in OG5_127212
Cryptosporidium hominis hypothetical protein Get druggable targets OG5_126888 All targets in OG5_126888
Toxoplasma gondii cell-cycle-associated protein kinase GSK, putative Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Cryptosporidium parvum protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma japonicum ko:K04456 RAC serine/threonine-protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans likely protein kinase similar to S. cerevisiae IPL1 (YPL209C) Aurora protein kinase involved in regulating kinetochore-microtubu Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative Get druggable targets OG5_127444 All targets in OG5_127444
Plasmodium falciparum glycogen synthase kinase 3 Get druggable targets OG5_126888 All targets in OG5_126888
Plasmodium yoelii putative protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma brucei Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Leishmania major target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Leishmania infantum target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis serine:threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Giardia lamblia Kinase, CMGC GSK Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica PH domain containing protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania mexicana protein kinase, putative,glycogen synthase kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum ko:K07203 FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma congolense Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit gamma, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trypanosoma congolense Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) AUR protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) AGC/PDK1 protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Entamoeba histolytica protein kinase domain containing protein Get druggable targets OG5_126888 All targets in OG5_126888
Onchocerca volvulus Get druggable targets OG5_126888 All targets in OG5_126888
Leishmania donovani Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica PH domain containing protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Cryptosporidium hominis protein kinase (EC 2.7.1.-) p46XlEg22 Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus multilocularis aurora kinase A Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica hypothetical protein Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans second truncated form of RIM11 Serine/threonine protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus granulosus serine:threonine protein kinase MARK2 Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis CMGC family protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Schistosoma mansoni glycogen synthase kinase 3-related (gsk3) (cmgc group III) Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus granulosus sodium:potassium dependent atpase beta subunit Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania mexicana phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trypanosoma cruzi aurora B kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma congolense aurora B kinase Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans likely protein kinase similar to S. cerevisiae YPK2 (YMR104C) Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus glycogen synthase kinase 3 beta Get druggable targets OG5_126888 All targets in OG5_126888
Plasmodium berghei rac-beta serine/threonine protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum ko:K08850 aurora kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Loa Loa (eye worm) phosphatidylinositol 3 Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_128024 All targets in OG5_128024
Plasmodium berghei glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma japonicum ko:K07390 monothiol glutaredoxin, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma mansoni ataxia telangiectasia mutated (atm)-related Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus FKBP12 rapamycin complex associated protein Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) CMGC/GSK protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_128785 All targets in OG5_128785
Echinococcus multilocularis serine:threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium knowlesi serine/threonine protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus multilocularis glycogen synthase kinase 3 beta Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus granulosus protein kinase shaggy Get druggable targets OG5_126888 All targets in OG5_126888
Trypanosoma brucei gambiense phosphatidylinositol 3-kinase tor, putative Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium yoelii Protein kinase domain, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum ko:K08822 glycogen synthase kinase 3 alpha, putative Get druggable targets OG5_126888 All targets in OG5_126888
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma congolense protein kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Loa Loa (eye worm) CAMK/CAMKL/MARK protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Echinococcus multilocularis serine threonine protein kinase nrc serine threonine protein kinase gad Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma cruzi rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi Protein kinase domain containing protein Get druggable targets OG5_128785 All targets in OG5_128785
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Babesia bovis protein kinase domain containing protein Get druggable targets OG5_126888 All targets in OG5_126888
Trypanosoma brucei gambiense protein kinase, putative,glycogen synthase kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Leishmania mexicana phosphatidylinositol 3 kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans frameshifted from upstream TOR2 CDS (CaP19.1905) Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) phosphatidylinositol 3 Get druggable targets OG5_127444 All targets in OG5_127444
Loa Loa (eye worm) AUR protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus multilocularis protein kinase shaggy Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus granulosus serine:threonine protein kinase 12 B Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans similar to N terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) putative protein/phosphatidylinositol kinases in Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum RAC serine/threonine-protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis rac serine:threonine kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma brucei phosphatidylinositol 3-kinase tor, putative Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus multilocularis serine:threonine protein kinase 12 B Get druggable targets OG5_127024 All targets in OG5_127024
Loa Loa (eye worm) AGC/AKT protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium falciparum serine/threonine protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Theileria parva glycogen synthase kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Candida albicans likely protein kinase similar to S. cerevisiae IPL1 (YPL209C) Aurora protein kinase involved in regulating kinetochore-microtubu Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica protein kinase 2, putative Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania major protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium berghei serine/threonine protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis CMGC family protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis phopsphatidylinositol 3-kinase, drosophila, putative Get druggable targets OG5_127444 All targets in OG5_127444
Candida albicans similar to internal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in n Get druggable targets OG5_127212 All targets in OG5_127212
Plasmodium falciparum RAC-beta serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein Get druggable targets OG5_127444 All targets in OG5_127444
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans similar to S. cerevisiae protein kinases PKH1 (YDR490C) and PKH2 (YOL100W) involved in MAPKKK cascade Get druggable targets OG5_128785 All targets in OG5_128785
Leishmania mexicana phosphatidylinositol 3-kinase (tor2)-like protein Get druggable targets OG5_127212 All targets in OG5_127212
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_127444 All targets in OG5_127444
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma mansoni protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans second truncated form of RIM11 Serine/threonine protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica FKBP-rapamycin associated protein (FRAP), putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Candida albicans similar to S. cerevisiae protein kinases PKH1 (YDR490C) and PKH2 (YOL100W) involved in MAPKKK cascade Get druggable targets OG5_128785 All targets in OG5_128785
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus 3-phosphoinositide-dependent protein kinase 1 Get druggable targets OG5_128785 All targets in OG5_128785
Schistosoma japonicum Sodium/potassium-transporting ATPase subunit beta-1, putative Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus serine:threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Echinococcus granulosus phosphatidylinositol 45 bisphosphate 3 kinase Get druggable targets OG5_127444 All targets in OG5_127444
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_128024 All targets in OG5_128024
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans frameshifted from upsteam TOR2 CDS (CaP19.9461) Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum FKBP12-rapamycin complex-associated protein, putative Get druggable targets OG5_127212 All targets in OG5_127212
Neospora caninum hypothetical protein Get druggable targets OG5_127024 All targets in OG5_127024
Entamoeba histolytica serine/threonine- protein kinase 6 , putative Get druggable targets OG5_127024 All targets in OG5_127024
Leishmania braziliensis protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma mansoni serine/threonine-protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Candida albicans hypothetical protein Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis phosphatidylinositol kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trypanosoma congolense rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium knowlesi glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus multilocularis serine:threonine protein kinase MARK2 Get druggable targets OG5_128024 All targets in OG5_128024
Echinococcus granulosus serine:threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Schistosoma mansoni serine/threonine-protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium vivax glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Brugia malayi serine/threonine protein kinase 6 Get druggable targets OG5_127024 All targets in OG5_127024
Loa Loa (eye worm) AUR protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Neospora caninum Phosphatidylinositol 3-kinase tor2, related Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi phosphoinositide-dependent protein kinase I Get druggable targets OG5_128785 All targets in OG5_128785
Trypanosoma brucei gambiense rac serine-threonine kinase, putative,protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus multilocularis Glutaredoxin protein 5 Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania braziliensis target of rapamycin (TOR) kinase 2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Schistosoma japonicum Serine/threonine-protein kinase 12, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma brucei rac serine-threonine kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania infantum glycogen synthase kinase 3 Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium vivax rac-beta serine/threonine protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica protein kinase domain containing protein Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Echinococcus multilocularis FKBP12 rapamycin complex associated protein Get druggable targets OG5_127212 All targets in OG5_127212
Toxoplasma gondii AGC kinase Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania braziliensis protein kinase, putative,glycogen synthase kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Schistosoma japonicum ko:K08798 MAP/microtubule affinity-regulating kinase, putative Get druggable targets OG5_128024 All targets in OG5_128024
Brugia malayi serine/threonine-protein kinase 6 Get druggable targets OG5_127024 All targets in OG5_127024
Plasmodium yoelii kinase Akt/PKB-related Get druggable targets OG5_126635 All targets in OG5_126635
Plasmodium knowlesi RAC-beta serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Neospora caninum hypothetical protein Get druggable targets OG5_126888 All targets in OG5_126888
Echinococcus multilocularis 3 phosphoinositide dependent protein kinase 1 Get druggable targets OG5_128785 All targets in OG5_128785
Neospora caninum Ribosomal protein S6 kinase alpha-6 (EC 2.7.11.1), related Get druggable targets OG5_126635 All targets in OG5_126635
Brugia malayi serine/threonine kinase 12 Get druggable targets OG5_127024 All targets in OG5_127024
Schistosoma japonicum ko:K08792 serum/glucocorticoid regulated kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania major glycogen synthase kinase, putative;with=GeneDB:LinJ18_V3.0270 Get druggable targets OG5_126888 All targets in OG5_126888
Schistosoma japonicum ko:K00922 phosphatidylinositol-4,5-bisphosphate 3-kinase [EC2.7.1.153], putative Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus granulosus calcium:calmodulin dependent protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania donovani Aurora I-related kinase Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans similar to N terminal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) putative protein/phosphatidylinositol kinases in Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica protein kinase , putative Get druggable targets OG5_127024 All targets in OG5_127024
Plasmodium vivax serine/threonine protein kinase 6, putative Get druggable targets OG5_127024 All targets in OG5_127024
Candida albicans likely protein kinase similar to S. cerevisiae KIN1 (YDR122W) and KIN2 (YLR096W) Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus aurora kinase A Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus multilocularis phosphatidylinositol 4,5 bisphosphate 3 kinase Get druggable targets OG5_127444 All targets in OG5_127444
Leishmania mexicana protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Giardia lamblia Aurora kinase Get druggable targets OG5_127024 All targets in OG5_127024
Leishmania donovani phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Entamoeba histolytica serine/threonine- protein kinase 6, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor2 Get druggable targets OG5_127212 All targets in OG5_127212
Entamoeba histolytica serine/threonine protein kinase 6, putative Get druggable targets OG5_127024 All targets in OG5_127024
Loa Loa (eye worm) CMGC/GSK protein kinase Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Schistosoma japonicum ko:K06276 3-phosphoinositide dependent protein kinase-1, putative Get druggable targets OG5_128785 All targets in OG5_128785
Loa Loa (eye worm) hypothetical protein Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei gambiense phosphatidylinositol 3 kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Entamoeba histolytica phosphatidylinositol3-kinaseTor2, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus multilocularis nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus serine/threonine protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Trypanosoma brucei protein kinase, putative Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Toxoplasma gondii aurora kinase Get druggable targets OG5_127024 All targets in OG5_127024
Echinococcus multilocularis serine:threonine protein kinase MARK2 Get druggable targets OG5_128024 All targets in OG5_128024
Entamoeba histolytica phosphatidylinositol 3-kinase, putative Get druggable targets OG5_127444 All targets in OG5_127444
Trypanosoma brucei phosphatidylinositol 4-kinase, putative Get druggable targets OG5_127212 All targets in OG5_127212
Brugia malayi p70 ribosomal S6 kinase beta Get druggable targets OG5_126635 All targets in OG5_126635
Giardia lamblia Kinase, AGC PKA Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma brucei aurora B kinase Get druggable targets OG5_127024 All targets in OG5_127024
Trypanosoma cruzi Protein kinase B Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania infantum phosphatidylinositol 3-kinase 2, putative Get druggable targets OG5_127444 All targets in OG5_127444
Loa Loa (eye worm) AGC/RSK/P70 protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_128024 All targets in OG5_128024
Candida albicans Serine/threonine protein kinase required for induction of IME2 by Ime1p Get druggable targets OG5_126888 All targets in OG5_126888
Candida albicans similar to internal region of S. cerevisiae TOR2 (YKL203C) and TOR1 (YJR066W) protein/phosphatidylinositol kinases involved in n Get druggable targets OG5_127212 All targets in OG5_127212
Trypanosoma brucei gambiense protein kinase, putative Get druggable targets OG5_127024 All targets in OG5_127024
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Echinococcus granulosus nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
Leishmania donovani glycogen synthase kinase 3, putative Get druggable targets OG5_126888 All targets in OG5_126888
Entamoeba histolytica protein kinase domain containing protein Get druggable targets OG5_126888 All targets in OG5_126888
Trichomonas vaginalis PIKK family atypical protein kinase Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania donovani Phosphatidylinositol 3-kinase tor1 Get druggable targets OG5_127212 All targets in OG5_127212
Leishmania major target of rapamycin (TOR) kinase 1, putative Get druggable targets OG5_127212 All targets in OG5_127212
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_126635 All targets in OG5_126635
Echinococcus granulosus Glutaredoxin protein 5 Get druggable targets OG5_126635 All targets in OG5_126635
Trichomonas vaginalis AGC family protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Echinococcus granulosus serine:threonine protein kinase MARK2 Get druggable targets OG5_128024 All targets in OG5_128024
Schistosoma mansoni serine/threonine protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Loa Loa (eye worm) AGC/PDK1 protein kinase Get druggable targets OG5_128785 All targets in OG5_128785
Leishmania infantum target of rapamycin (TOR) kinase 1, putative Get druggable targets OG5_127212 All targets in OG5_127212
Giardia lamblia Kinase, CMGC GSK Get druggable targets OG5_126888 All targets in OG5_126888
Plasmodium yoelii Protein kinase domain, putative Get druggable targets OG5_126888 All targets in OG5_126888
Giardia lamblia Phosphoinositide-3-kinase, catalytic, alpha polypeptide Get druggable targets OG5_127444 All targets in OG5_127444
Echinococcus granulosus nervana 2 Get druggable targets OG5_126635 All targets in OG5_126635
By sequence similarity to non orthologous known druggable targets
Species Potential target Known druggable target Length Alignment span Identity
Entamoeba histolytica phosphatidylinositol 3-kinase, putative phosphatidylinositol 3-kinase, catalytic, alpha polypeptide 1068 aa 927 aa 29.0 %
Obtained from network model

Ranking Plot

Putative Targets List

Species Potential target Raw Global Species
Echinococcus granulosus serine:threonine protein kinase 12 B 0.007 0.0544 0.0529
Loa Loa (eye worm) CMGC/GSK protein kinase 0.006 0.044 0.0424
Schistosoma mansoni serine/threonine protein kinase 0.0039 0.0224 0.0208
Plasmodium vivax serine/threonine protein kinase 6, putative 0.007 0.0544 1
Trichomonas vaginalis diacylglycerol kinase, putative 0.0038 0.0217 0.2
Trypanosoma cruzi diacylglycerol kinase-like protein, putative 0.0038 0.0217 0.1877
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0019 0.0016 0.0151
Echinococcus granulosus serine:threonine protein kinase MARK2 0.0088 0.073 0.0715
Giardia lamblia Aurora kinase 0.007 0.0544 1
Echinococcus granulosus ceramide kinase 0.0038 0.0217 0.0201
Plasmodium falciparum glycogen synthase kinase 3 0.006 0.044 0.8016
Plasmodium vivax diacylglycerol kinase, putative 0.0038 0.0217 0.3794
Echinococcus granulosus serine:threonine protein kinase 0.0051 0.0349 0.0333
Loa Loa (eye worm) hypothetical protein 0.0037 0.0201 0.0185
Echinococcus multilocularis serine:threonine protein kinase 0.0051 0.0349 0.0333
Echinococcus multilocularis protein kinase shaggy 0.006 0.044 0.0424
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative 0.0085 0.0699 0.6454
Entamoeba histolytica FKBP-rapamycin associated protein (FRAP), putative 0.0058 0.042 0.0404
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0275 0.2541
Trypanosoma cruzi phosphatidylinositol 3-kinase, putative 0.0036 0.0194 0.1668
Entamoeba histolytica protein kinase, putative 0.004 0.0231 0.0215
Plasmodium falciparum RAC-beta serine/threonine protein kinase 0.0027 0.01 0.1586
Trypanosoma brucei phosphatidylinositol 3-related kinase, putative 0.0022 0.0045 0.0549
Trichomonas vaginalis bmru protein, putative 0.0038 0.0217 0.2
Loa Loa (eye worm) ceramide kinase 0.0038 0.0217 0.0201
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0056 0.0401 0.0385
Brugia malayi intracellular kinase 0.006 0.044 0.3966
Entamoeba histolytica protein kinase, putative 0.006 0.0448 0.0432
Trichomonas vaginalis AGC family protein kinase 0.0042 0.0257 0.237
Trichomonas vaginalis phosphatidylinositol 4-kinase, putative 0.0019 0.0016 0.0151
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0161 0.1482
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0161 0.1482
Trichomonas vaginalis bmru protein, putative 0.0038 0.0217 0.2
Leishmania major target of rapamycin (TOR) kinase 1, putative 0.0058 0.042 0.7637
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0193 0.1781
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor1 0.0058 0.042 0.3778
Entamoeba histolytica diacylglycerol kinase, putative 0.0038 0.0217 0.0201
Plasmodium vivax diacylglycerol kinase, putative 0.0038 0.0217 0.3794
Leishmania major diacylglycerol kinase-like protein 0.0038 0.0217 0.3794
Loa Loa (eye worm) phosphatidylinositol 3 0.0202 0.1914 0.1901
Entamoeba histolytica protein kinase, putative 0.006 0.044 0.0424
Loa Loa (eye worm) hypothetical protein 0.008 0.0651 0.0636
Echinococcus multilocularis Diacylglycerol kinase zeta 0.0038 0.0217 0.0201
Trypanosoma cruzi rac serine-threonine kinase, putative 0.0029 0.0126 0.1026
Loa Loa (eye worm) diacylglycerol kinase 2 0.0038 0.0217 0.0201
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.008 0.0651 0.5949
Trypanosoma brucei phosphatidylinositol 3-kinase, putative 0.0022 0.0045 0.0549
Trichomonas vaginalis sphingosine kinase, putative 0.0038 0.0217 0.2
Entamoeba histolytica protein kinase, putative 0.0042 0.0257 0.0241
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0043 0.0267 0.2348
Trichomonas vaginalis AGC family protein kinase 0.0042 0.0257 0.237
Schistosoma mansoni serine/threonine protein kinase 0.0088 0.073 0.0715
Trichomonas vaginalis diacylglycerol kinase, putative 0.0038 0.0217 0.2
Trichomonas vaginalis AGC family protein kinase 0.006 0.0448 0.4133
Echinococcus multilocularis phosphatidylinositol 4 phosphate 3 kinase C2 0.008 0.0651 0.0636
Echinococcus granulosus phosphatidylinositol 4 phosphate 3 kinase C2 0.008 0.0651 0.0636
Entamoeba histolytica diacylglycerol kinase, putative 0.0038 0.0217 0.0201
Echinococcus granulosus Diacylglycerol kinase zeta 0.0038 0.0217 0.0201
Echinococcus granulosus nervana 2 0.0025 0.0077 0.0061
Entamoeba histolytica protein kinase domain containing protein 0.006 0.044 0.0424
Trichomonas vaginalis CMGC family protein kinase 0.006 0.044 0.4057
Trichomonas vaginalis conserved hypothetical protein 0.0038 0.0217 0.2
Trypanosoma cruzi diacylglycerol kinase-like protein, putative 0.0038 0.0217 0.1877
Trichomonas vaginalis PIKK family atypical protein kinase 0.0039 0.0222 0.2049
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0058 0.042 0.3778
Plasmodium vivax glycogen synthase kinase 3, putative 0.006 0.044 0.8016
Leishmania major diacylglycerol kinase, putative 0.0038 0.0217 0.3794
Echinococcus granulosus phosphatidylinositol 45 bisphosphate 3 kinase 0.0226 0.2164 0.2152
Echinococcus granulosus calcium:calmodulin dependent protein kinase 0.0027 0.01 0.0084
Brugia malayi diacylglycerol kinase 0.0038 0.0217 0.1877
Echinococcus granulosus acylglycerol kinase mitochondrial 0.0038 0.0217 0.0201
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0019 0.0016 0.0151
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta, putative 0.0043 0.0267 0.2464
Trypanosoma brucei phosphatidylinositol 3-kinase tor, putative 0.0029 0.0123 0.2016
Brugia malayi phosphoinositide 3'-hydroxykinase p110-alpha subunit, putative 0.0104 0.0901 0.8289
Loa Loa (eye worm) CMGC/GSK protein kinase 0.006 0.044 0.0424
Trichomonas vaginalis sphingosine kinase, putative 0.0038 0.0217 0.2
Toxoplasma gondii cell-cycle-associated protein kinase GSK, putative 0.006 0.044 0.8016
Trypanosoma cruzi diacylglycerol kinase, putative 0.0038 0.0217 0.1877
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0098 0.0833 0.0818
Trypanosoma cruzi Protein kinase B 0.0029 0.0126 0.1026
Loa Loa (eye worm) hypothetical protein 0.0038 0.0217 0.0201
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0275 0.2541
Giardia lamblia GTOR 0.0058 0.042 0.7192
Plasmodium falciparum diacylglycerol kinase, putative 0.0038 0.0217 0.3794
Schistosoma mansoni protein kinase 0.007 0.0544 0.0529
Echinococcus multilocularis serine:threonine protein kinase MARK2 0.0088 0.073 0.0715
Brugia malayi Protein kinase domain containing protein 0.0042 0.0257 0.2253
Toxoplasma gondii diacylglycerol kinase, putative 0.0038 0.0217 0.3794
Echinococcus granulosus serine:threonine protein kinase 0.0051 0.0349 0.0333
Schistosoma mansoni serine/threonine protein kinase 0.007 0.0544 0.0529
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0043 0.0267 0.2464
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.016 0.1477
Trypanosoma cruzi rac serine-threonine kinase, putative 0.0027 0.01 0.0785
Entamoeba histolytica serine/threonine protein kinase 6, putative 0.007 0.0544 0.0529
Loa Loa (eye worm) hypothetical protein 0.0051 0.0349 0.0333
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0045 0.0418
Echinococcus granulosus serine/threonine protein kinase 0.0029 0.0126 0.011
Loa Loa (eye worm) phosphatidylinositol 3 0.0022 0.0045 0.0029
Echinococcus multilocularis sphingosine kinase 1 0.0981 1 1
Schistosoma mansoni diacylglycerol kinase zeta iota 0.0038 0.0217 0.0201
Echinococcus multilocularis ceramide kinase 0.0038 0.0217 0.0201
Trypanosoma brucei Sphingosine kinase 0.0038 0.0217 0.3794
Entamoeba histolytica protein kinase , putative 0.007 0.0544 0.0529
Brugia malayi serine/threonine protein kinase 6 0.007 0.0544 0.4947
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0304 0.2809
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0304 0.2809
Trichomonas vaginalis phopsphatidylinositol 3-kinase, drosophila, putative 0.0122 0.1084 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.005 0.0337 0.3112
Leishmania major protein kinase, putative 0.007 0.0544 1
Echinococcus multilocularis hypothetical protein 0.0037 0.0201 0.0185
Entamoeba histolytica protein kinase 2, putative 0.0027 0.01 0.0084
Mycobacterium tuberculosis Conserved protein 0.0981 1 1
Entamoeba histolytica hypothetical protein, conserved 0.0981 1 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0161 0.1482
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0043 0.0267 0.0251
Schistosoma mansoni hypothetical protein 0.0038 0.0217 0.0201
Entamoeba histolytica serine/threonine- protein kinase 6 , putative 0.007 0.0544 0.0529
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative 0.0022 0.0045 0.0272
Trichomonas vaginalis PIKK family atypical protein kinase 0.004 0.0234 0.2161
Brugia malayi Kinase associated domain 1 family protein 0.0037 0.0201 0.1731
Trypanosoma brucei rac serine-threonine kinase, putative 0.0042 0.0257 0.4554
Trypanosoma brucei Diacylglycerol kinase catalytic domain containing protein, putative 0.0038 0.0217 0.3794
Loa Loa (eye worm) AUR protein kinase 0.007 0.0544 0.0529
Echinococcus multilocularis serine threonine protein kinase nrc serine threonine protein kinase gad 0.0027 0.01 0.0084
Echinococcus multilocularis calcium activated potassium channel 0.0039 0.0224 0.0208
Echinococcus granulosus protein kinase shaggy 0.006 0.044 0.0424
Trichomonas vaginalis AGC family protein kinase 0.0042 0.0257 0.237
Toxoplasma gondii AGC kinase 0.004 0.0231 0.4067
Loa Loa (eye worm) hypothetical protein 0.0981 1 1
Trypanosoma cruzi target of rapamycin kinase 3 0.0047 0.0305 0.2703
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0275 0.2541
Entamoeba histolytica protein kinase domain containing protein 0.007 0.0544 0.0529
Entamoeba histolytica PH domain containing protein kinase, putative 0.0029 0.0126 0.011
Echinococcus granulosus nervana 2 0.0025 0.0077 0.0061
Brugia malayi Diacylglycerol kinase protein 2 0.0038 0.0217 0.1877
Echinococcus multilocularis glycogen synthase kinase 3 beta 0.006 0.044 0.0424
Plasmodium falciparum serine/threonine protein kinase, putative 0.007 0.0544 1
Trypanosoma brucei target of rapamycin kinase 3, putative 0.0047 0.0305 0.5464
Plasmodium vivax rac-beta serine/threonine protein kinase, putative 0.0027 0.01 0.1586
Echinococcus multilocularis serine:threonine protein kinase 12 B 0.007 0.0544 0.0529
Trypanosoma cruzi phosphatidylinositol 3-kinase vps34-like 0.0043 0.0267 0.2348
Schistosoma mansoni serine/threonine protein kinase 0.0088 0.073 0.0715
Loa Loa (eye worm) phosphatidylinositol 3 0.0036 0.0194 0.0178
Echinococcus multilocularis serine:threonine protein kinase 0.0051 0.0349 0.0333
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.016 0.1477
Giardia lamblia Phosphoinositide-3-kinase, catalytic, alpha polypeptide 0.0061 0.0449 0.7846
Trichomonas vaginalis diacylglycerol kinase, zeta, iota, putative 0.0038 0.0217 0.2
Loa Loa (eye worm) eye-specific diacylglycerol kinase 0.0038 0.0217 0.0201
Loa Loa (eye worm) AGC/PDK1 protein kinase 0.006 0.0448 0.0432
Trypanosoma cruzi diacylglycerol kinase, putative 0.0038 0.0217 0.1877
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K 0.0226 0.2164 0.2152
Brugia malayi p70 ribosomal S6 kinase beta 0.004 0.0231 0.2012
Echinococcus multilocularis nervana 2 0.0025 0.0077 0.0061
Echinococcus granulosus sodium:potassium dependent atpase beta subunit 0.0025 0.0077 0.0061
Entamoeba histolytica phosphatidylinositol3-kinaseTor2, putative 0.0058 0.042 0.0404
Echinococcus granulosus phosphatidylinositol 3 and 4 kinase 0.0022 0.0045 0.0029
Entamoeba histolytica diacylglycerol kinase, putative 0.0038 0.0217 0.0201
Plasmodium falciparum diacylglycerol kinase, putative 0.0038 0.0217 0.3794
Echinococcus granulosus FKBP12 rapamycin complex associated protein 0.0058 0.042 0.0404
Brugia malayi Ceramide kinase 0.0038 0.0217 0.1877
Echinococcus multilocularis Diacylglycerol kinase theta 0.0038 0.0217 0.0201
Schistosoma mansoni phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K 0.0043 0.0267 0.0251
Echinococcus granulosus Glutaredoxin protein 5 0.0025 0.0077 0.0061
Trypanosoma brucei Phosphatidylinositol 3-kinase tor1 0.0058 0.042 0.7637
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0122 0.1084 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0045 0.0418
Schistosoma mansoni hypothetical protein 0.0037 0.0201 0.0185
Entamoeba histolytica protein kinase, putative 0.007 0.0544 0.0529
Toxoplasma gondii target of rapamycin (TOR), putative 0.0044 0.0275 0.4904
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0045 0.0418
Schistosoma mansoni phosphatidylinositol 3-and 4-kinase 0.0022 0.0045 0.0029
Echinococcus multilocularis acylglycerol kinase, mitochondrial 0.0038 0.0217 0.0201
Echinococcus granulosus calcium activated potassium channel 0.0039 0.0224 0.0208
Trichomonas vaginalis AGC family protein kinase 0.007 0.0544 0.5024
Schistosoma mansoni serine/threonine kinase 0.0039 0.0224 0.0208
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0043 0.0267 0.2464
Trypanosoma brucei aurora B kinase 0.007 0.0544 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.016 0.1477
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0304 0.2809
Mycobacterium ulcerans hypothetical protein 0.0981 1 1
Echinococcus multilocularis Glutaredoxin protein 5 0.0025 0.0077 0.0061
Echinococcus granulosus serine threonine protein kinase nrc 0.0027 0.01 0.0084
Entamoeba histolytica protein kinase, putative 0.0042 0.0257 0.0241
Entamoeba histolytica protein kinase domain containing protein 0.006 0.044 0.0424
Schistosoma mansoni serine/threonine protein kinase 0.0039 0.0224 0.0208
Brugia malayi phosphoinositide-dependent protein kinase I 0.006 0.0448 0.4043
Schistosoma mansoni hypothetical protein 0.0037 0.0201 0.0185
Leishmania major sphingosine kinase A, B, putative 0.0038 0.0217 0.3794
Entamoeba histolytica phosphatidylinositol 3-kinase 1, putative 0.0115 0.1011 0.0996
Trichomonas vaginalis AGC family protein kinase 0.0042 0.0257 0.237
Brugia malayi serine/threonine-protein kinase 6 0.007 0.0544 0.4947
Echinococcus multilocularis aurora kinase A 0.007 0.0544 0.0529
Trichomonas vaginalis phosphatidylinositol kinase, putative 0.0122 0.1084 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0275 0.2541
Schistosoma mansoni serine/threonine protein kinase 0.0039 0.0224 0.0208
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0275 0.2541
Trichomonas vaginalis AGC family protein kinase 0.007 0.0544 0.5024
Trypanosoma brucei protein kinase, putative 0.006 0.044 0.8016
Echinococcus multilocularis serine:threonine protein kinase MARK2 0.0088 0.073 0.0715
Schistosoma mansoni diacylglycerol kinase theta 0.0038 0.0217 0.0201
Trichomonas vaginalis phosphatidylinositol 3-kinase catalytic subunit gamma, putative 0.0122 0.1084 1
Loa Loa (eye worm) hypothetical protein 0.0038 0.0217 0.0201
Trypanosoma cruzi Diacylglycerol kinase catalytic domain containing protein, putative 0.0038 0.0217 0.1877
Leishmania major glycogen synthase kinase, putative;with=GeneDB:LinJ18_V3.0270 0.006 0.044 0.8016
Schistosoma mansoni serine/threonine-protein kinase 0.0029 0.0126 0.011
Giardia lamblia Phosphoinositide-3-kinase, class 3 0.0031 0.0143 0.0976
Echinococcus multilocularis phosphatidylinositol 4,5 bisphosphate 3 kinase 0.0226 0.2164 0.2152
Trypanosoma brucei diacylglycerol kinase, putative 0.0038 0.0217 0.3794
Trichomonas vaginalis PIKK family atypical protein kinase 0.0033 0.0161 0.1482
Loa Loa (eye worm) CAMK/CAMKL/MELK protein kinase 0.0039 0.0224 0.0208
Loa Loa (eye worm) CAMK/CAMKL/MARK protein kinase 0.0051 0.0349 0.0333
Trichomonas vaginalis AGC family protein kinase 0.0042 0.0257 0.237
Brugia malayi Protein kinase domain containing protein 0.0051 0.0349 0.3116
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0045 0.0418
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative 0.0122 0.1084 1
Leishmania major target of rapamycin kinase (TOR) kinase 3 0.0047 0.0305 0.5464
Trichomonas vaginalis diacylglycerol kinase, zeta, iota, putative 0.0038 0.0217 0.2
Brugia malayi Protein kinase domain containing protein 0.0039 0.0224 0.1947
Entamoeba histolytica protein kinase, putative 0.007 0.0544 0.0529
Entamoeba histolytica diacylglycerol kinase, putative 0.0038 0.0217 0.0201
Brugia malayi serine/threonine kinase 12 0.007 0.0544 0.4947
Loa Loa (eye worm) hypothetical protein 0.0038 0.0217 0.0201
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.042 0.3872
Echinococcus multilocularis FKBP12 rapamycin complex associated protein 0.0058 0.042 0.0404
Entamoeba histolytica serine/threonine- protein kinase 6, putative 0.007 0.0544 0.0529
Trichomonas vaginalis AGC family protein kinase 0.006 0.0448 0.4133
Loa Loa (eye worm) hypothetical protein 0.0042 0.0253 0.0237
Trichomonas vaginalis CMGC family protein kinase 0.006 0.044 0.4057
Echinococcus multilocularis phosphatidylinositol 3 and 4 kinase 0.0022 0.0045 0.0029
Schistosoma mansoni ataxia telangiectasia mutated (atm)-related 0.0058 0.042 0.0404
Trichomonas vaginalis diacylglycerol kinase, epsilon, putative 0.0038 0.0217 0.2
Leishmania major target of rapamycin (TOR) kinase 2, putative 0.0058 0.042 0.7637
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0193 0.1781
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0304 0.2809
Trypanosoma cruzi Sphingosine kinase 0.0038 0.0217 0.1877
Leishmania major hypothetical protein, conserved 0.0038 0.0217 0.3794
Entamoeba histolytica PH domain containing protein kinase, putative 0.0029 0.0126 0.011
Loa Loa (eye worm) AGC/PDK1 protein kinase 0.006 0.0448 0.0432
Loa Loa (eye worm) phosphatidylinositol 3 0.0058 0.042 0.0404
Toxoplasma gondii aurora kinase 0.007 0.0544 1
Trypanosoma cruzi phosphatidylinositol 3-kinase 2, putative 0.0122 0.1084 1
Brugia malayi diacylglycerol kinase 0.0038 0.0217 0.1877
Trichomonas vaginalis phosphatidylinositol 3-kinase class, putative 0.0085 0.0699 0.6454
Schistosoma mansoni proteasome subunit alpha 6 (T01 family) 0.0038 0.0217 0.0201
Trichomonas vaginalis PIKK family atypical protein kinase 0.0018 0.0008 0.007
Schistosoma mansoni sphingoid long chain base kinase 0.0981 1 1
Giardia lamblia Kinase, CMGC GSK 0.006 0.044 0.7642
Toxoplasma gondii diacylglycerol kinase catalytic domain-containing protein 0.0038 0.0217 0.3794
Loa Loa (eye worm) AUR protein kinase 0.007 0.0544 0.0529
Trypanosoma cruzi Sphingosine kinase 0.0038 0.0217 0.1877
Trypanosoma cruzi glycogen synthase kinase 3, putative 0.006 0.044 0.3966
Trichomonas vaginalis CAMK family protein kinase 0.0039 0.0224 0.2069
Echinococcus multilocularis nervana 2 0.0025 0.0077 0.0061
Brugia malayi Protein kinase domain containing protein 0.006 0.0448 0.4043
Leishmania major phosphatidylinositol 3-related kinase, putative 0.0022 0.0045 0.0549
Schistosoma mansoni serine/threonine-protein kinase 0.0029 0.0126 0.011
Brugia malayi Eye-specific diacylglycerol kinase 0.0038 0.0217 0.1877
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.019 0.175
Loa Loa (eye worm) AGC/AKT protein kinase 0.0042 0.0257 0.0241
Echinococcus granulosus Diacylglycerol kinase theta 0.0038 0.0217 0.0201
Trichomonas vaginalis CAMK family protein kinase 0.0051 0.0349 0.322
Echinococcus multilocularis rac serine:threonine kinase 0.0029 0.0126 0.011
Schistosoma mansoni serine/threonine protein kinase 0.006 0.0448 0.0432
Trypanosoma cruzi aurora B kinase, putative 0.007 0.0544 0.4947
Trypanosoma brucei hypothetical protein, conserved 0.0038 0.0217 0.3794
Loa Loa (eye worm) AUR protein kinase 0.007 0.0544 0.0529
Onchocerca volvulus 0.006 0.044 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.0193 0.1781
Schistosoma mansoni glycogen synthase kinase 3-related (gsk3) (cmgc group III) 0.006 0.044 0.0424
Echinococcus multilocularis sodium:potassium dependent atpase beta subunit 0.0025 0.0077 0.0061
Trypanosoma cruzi phosphatidylinositol 3-related kinase, putative 0.0022 0.0045 0.0272
Leishmania major phosphatidylinositol 3-kinase, putative 0.0022 0.0045 0.0549
Trichomonas vaginalis PIKK family atypical protein kinase 0.0047 0.0304 0.2809
Brugia malayi Phosphatidylinositol 3- and 4-kinase family protein 0.0022 0.0045 0.0272
Giardia lamblia Kinase, CMGC GSK 0.006 0.044 0.7642
Trichomonas vaginalis AGC family protein kinase 0.007 0.0544 0.5024
Leishmania major hypothetical protein, conserved 0.0038 0.0217 0.3794
Trypanosoma brucei FAT domain/Rapamycin binding domain/Phosphatidylinositol 3- and 4-kinase, putative 0.0026 0.009 0.1402
Echinococcus granulosus glycogen synthase kinase 3 beta 0.006 0.044 0.0424
Trypanosoma brucei phosphatidylinositol 4-kinase, putative 0.0058 0.042 0.7637
Trichomonas vaginalis PIKK family atypical protein kinase 0.0036 0.019 0.175
Echinococcus multilocularis 3 phosphoinositide dependent protein kinase 1 0.006 0.0448 0.0432
Trichomonas vaginalis PIKK family atypical protein kinase 0.0022 0.0045 0.0418
Toxoplasma gondii diacylglycerol kinase accessory domain (presumed) domain-containing protein 0.0038 0.0217 0.3794
Trypanosoma cruzi Phosphatidylinositol 3-kinase tor2 0.0058 0.042 0.3778
Echinococcus granulosus 3-phosphoinositide-dependent protein kinase 1 0.006 0.0448 0.0432
Echinococcus granulosus serine:threonine protein kinase MARK2 0.0088 0.073 0.0715
Echinococcus granulosus aurora kinase A 0.007 0.0544 0.0529
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.042 0.3872
Schistosoma mansoni diacylglycerol kinase theta 0.0038 0.0217 0.0201
Entamoeba histolytica hypothetical protein 0.0098 0.0833 0.0818
Trypanosoma brucei phosphatidylinositol 3-kinase, putative 0.0043 0.0267 0.4747
Trichomonas vaginalis AGC family protein kinase 0.006 0.0448 0.4133
Schistosoma mansoni sphingosine kinase A B 0.0981 1 1
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0275 0.2541
Trichomonas vaginalis PIKK family atypical protein kinase 0.0044 0.0275 0.2541
Trichomonas vaginalis AGC family protein kinase 0.007 0.0544 0.5024
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0122 0.1084 0.1069
Trichomonas vaginalis AGC family protein kinase 0.0042 0.0257 0.237
Entamoeba histolytica phosphatidylinositol 3-kinase, putative 0.0043 0.0267 0.0251
Trypanosoma cruzi hypothetical protein, conserved 0.0038 0.0217 0.1877
Brugia malayi hypothetical protein 0.0038 0.0217 0.1877
Trichomonas vaginalis AGC family protein kinase 0.0042 0.0257 0.237
Trichomonas vaginalis PIKK family atypical protein kinase 0.0058 0.042 0.3872
Loa Loa (eye worm) AGC/RSK/P70 protein kinase 0.004 0.0231 0.0215

Activities

Activity type Activity value Assay description Source Reference
EC50 (functional) = 1900 nM Antiproliferative activity against human H460 cells after 72 hrs by resazurin reduction assay ChEMBL. 22040023
EC50 (functional) = 2200 nM Antiproliferative activity against human A549 cells after 72 hrs by resazurin reduction assay ChEMBL. 22040023
IC50 (binding) = 70 nM Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human SKOV3 cells after 2 hrs by ELISA ChEMBL. 22040023
IC50 (binding) = 80 nM Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human A549 cells after 2 hrs by ELISA ChEMBL. 22040023
IC50 (binding) = 160 nM Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA ChEMBL. 22040023
IC50 (binding) = 340 nM Inhibition of GSK3-beta ChEMBL. 22040023
IC50 (binding) = 460 nM Inhibition of Aurora A ChEMBL. 22040023
IC50 (binding) = 590 nM Inhibition of MARK1 ChEMBL. 22040023
IC50 (binding) = 620 nM Inhibition of TrkA ChEMBL. 22040023
Inhibition (binding) = -8 % Inhibition of MYLK2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = -4 % Inhibition of MAPK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = -2 % Inhibition of NEK2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 1 % Inhibition of EPHA2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 1 % Inhibition of EGFR at 1 uM ChEMBL. 22040023
Inhibition (binding) = 2 % Inhibition of MAPKAPK2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 3 % Inhibition of INSR at 1 uM ChEMBL. 22040023
Inhibition (binding) = 4 % Inhibition of CSNK1A1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 4 % Inhibition of TAOK2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 5 % Inhibition of ROCK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 6 % Inhibition of JAK3 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 7 % Inhibition of FGFR1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 7 % Inhibition of PIM2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 8 % Inhibition of MET at 1 uM ChEMBL. 22040023
Inhibition (binding) = 8 % Inhibition of CSNK2A2 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 8 % Inhibition of MST4 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 12 % Inhibition of STK3 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 19 % Inhibition of TEK at 1 uM ChEMBL. 22040023
Inhibition (binding) = 21 % Inhibition of SRC at 1 uM ChEMBL. 22040023
Inhibition (binding) = 22 % Inhibition of LCK at 1 uM ChEMBL. 22040023
Inhibition (binding) = 24 % Inhibition of CHEK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 34 % Inhibition of CDK2/cyclinA at 1 uM ChEMBL. 22040023
Inhibition (ADMET) = 37 % Inhibition of CYP1A2 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 37 % Inhibition of CYP2C9 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 37 % Inhibition of CYP2D6 at 3 uM ChEMBL. 22040023
Inhibition (ADMET) = 37 % Inhibition of CYP3A4 at 3 uM ChEMBL. 22040023
Inhibition (binding) = 46 % Inhibition of PAK4 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 50 % Inhibition of MAP4K4 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 51 % Inhibition of KDR at 1 uM ChEMBL. 22040023
Inhibition (binding) = 57 % Inhibition of AKT1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 58 % Inhibition of PRKACA at 1 uM ChEMBL. 22040023
Inhibition (binding) = 61 % Inhibition of SGK at 1 uM ChEMBL. 22040023
Inhibition (binding) = 63 % Inhibition of NTRK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 73 % Inhibition of CAMK2A at 1 uM ChEMBL. 22040023
Inhibition (binding) = 74 % Inhibition of MARK1 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 76 % Inhibition of GSK3B at 1 uM ChEMBL. 22040023
Inhibition (binding) = 80 % Inhibition of STK6 at 1 uM ChEMBL. 22040023
Inhibition (binding) = 99 % Inhibition of CHEK2 at 1 uM ChEMBL. 22040023
Ki (binding) = 1.4 nM Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence-based spectrophotometry ChEMBL. 22040023
Ki (binding) = 360 nM Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assay ChEMBL. 22040023
Ki (binding) = 1300 nM Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assay ChEMBL. 22040023
Ki (binding) = 2600 nM Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assay ChEMBL. 22040023

Phenotypes

Whole-cell/tissue/organism interactions

Species name Source Reference Is orphan
Homo sapiens ChEMBL23 22040023

Many chemical entities in TDR Targets come from high-throughput screenings with whole cells or tissue samples, and not all assayed compounds have been tested against a single a single target protein, probably because they get ruled out during screening process. Even if these compounds may have not been of interest in the original screening, they may come as interesting leads for other screening assays. Furthermore, we may be able to propose drug-target associations using chemical similarities and network patterns.

Annotated phenotypes:

We have no manually annotated phenotypes for this drug. What does this mean? / Care to help?
In TDR Targets, information about phenotypes that are caused by drugs, or by genetic manipulation of cells (e.g. gene knockouts or knockdowns) is manually curated from the literature. These descriptions help to describe the potential of the target for drug development. If no information is available for this gene or if the information is incomplete, this may mean that i) the papers containing this information either appeared after the curation effort for this organism was carried out or they were inadvertently missed by curators; or that ii) the curation effort for this organism has not yet started.
 
In any case, if you have information about papers containing relevant validation data for this target, please log in using your TDR Targets username and password and send them to us using the corresponding form in this page (only visible to registered users) or contact us.

External resources for this compound

Bibliographic References

1 literature reference was collected for this gene.

If you have references for this compound, please enter them in a user comment (below) or Contact us.